![Immunocytochemistry/Immunofluorescence: SLC38A6 Antibody [NBP1-81010] - Immunofluorescent staining of human cell line U-251 MG shows localization to microtubules & cell junctions.](http://images.novusbio.com/fullsize/SLC38A6-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81010-img0007.jpg "Immunocytochemistry/Immunofluorescence: SLC38A6 Antibody [NBP1-81010] - Immunofluorescent staining of human cell line U-251 MG shows localization to microtubules & cell junctions.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KWSIPCPLTLNYVEKGFQISNVTDDCKPKLFHFSKESA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC38A6 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. IHC reported in the literature (PMID: 24752331). |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-81010 | Applications | Species |
|---|---|---|
| Bagchi S, Baomar HA, Al-Walai S et al. Histological Analysis of SLC38A6 (SNAT6) Expression in Mouse Brain Shows Selective Expression in Excitatory Neurons with High Expression in the Synapses. PLoS One 2014-01-01 [PMID: 24752331] (IF/IHC, Mouse) | IF/IHC | Mouse |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: SLC38A6 Antibody [NBP1-81010] - Staining of human prostate shows strong membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/SLC38A6-Antibody-Immunohistochemistry-Paraffin-NBP1-81010-img0011.jpg "Immunohistochemistry-Paraffin: SLC38A6 Antibody [NBP1-81010] - Staining of human prostate shows strong membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: SLC38A6 Antibody [NBP1-81010] - Staining of human cerebral cortex shows moderate membranous positivity in neurons.](http://images.novusbio.com/fullsize/SLC38A6-Antibody-Immunohistochemistry-Paraffin-NBP1-81010-img0008.jpg "Immunohistochemistry-Paraffin: SLC38A6 Antibody [NBP1-81010] - Staining of human cerebral cortex shows moderate membranous positivity in neurons.")
![Immunohistochemistry-Paraffin: SLC38A6 Antibody [NBP1-81010] - Staining of human liver shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/SLC38A6-Antibody-Immunohistochemistry-Paraffin-NBP1-81010-img0009.jpg "Immunohistochemistry-Paraffin: SLC38A6 Antibody [NBP1-81010] - Staining of human liver shows no positivity in glandular cells as expected.")
![Immunohistochemistry-Paraffin: SLC38A6 Antibody [NBP1-81010] - Staining of human small intestine shows moderate membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/SLC38A6-Antibody-Immunohistochemistry-Paraffin-NBP1-81010-img0010.jpg "Immunohistochemistry-Paraffin: SLC38A6 Antibody [NBP1-81010] - Staining of human small intestine shows moderate membranous positivity in glandular cells.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")