Home » NAPRT1 » NAPRT1 Proteins » NAPRT1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

NAPRT1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for NAPRT1 Protein (NBP1-87244PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

NAPRT1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NAPRT1.

Source: E. coli

Amino Acid Sequence: PAFFEHLRALDCSEVTVRALPEGSLAFPGVPLLQVSGPLLVVQLLETPLLCLVSYASLVATNAARLRLIAGP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NAPRT
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87244.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NAPRT1 Recombinant Protein Antigen

  • EC 2.4.2.11
  • FHA-HIT-interacting protein
  • FHIP
  • NAPRTase
  • nicotinate phosphoribosyltransferase domain containing 1
  • Nicotinate phosphoribosyltransferase domain-containing protein 1
  • nicotinate phosphoribosyltransferase
  • nicotinic acid phosphoribosyltransferase
  • PP3856

Background

Nicotinic acid (NA; niacin) is converted by nicotinic acid phosphoribosyltransferase (NAPRT; EC 2.4.2.11) to NA mononucleotide (NaMN), which is then converted to NA adenine dinucleotide (NaAD), and finally to nicotinamide adenine dinucleotide (NAD), which serves as a coenzyme in cellular redox reactions and is an essential component of a variety of processes in cellular metabolism including response to stress (Hara et al., 2007).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...


PBEF/Visfatin/NAMPT An
NB100-594
Western Blot PBEF/Visfatin/NAMPT Antibody
Western Blot PBEF/Visfatin/NAMPT Antibody
Immunohistochemistry-Paraffin PBEF/Visfatin/NAMPT Antibody
(10 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Glutaminyl-peptide
Cyclotransferase/QPCT ...
NBP1-81838
Western Blot Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry-Paraffin Glutaminyl-peptide Cyclotransferase/QPCT Antibody
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
HPRT Antibody
NBP1-33527
Western Blot HPRT Antibody
Western Blot HPRT Antibody
Immunohistochemistry-Paraffin HPRT Antibody
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Sir2.1 Antibody
NB100-1923
Western Blot Sir2.1 Antibody
(1 Review)
(2 Publications)
Species: Ce
Applications: IHC, IHC-P, IP, WB
Cathepsin
A/Lysosomal Carboxype ...
AF1049
Immunohistochemistry Cathepsin A/Lysosomal Carboxypeptidase A Antibody
(1 Review)
(6 Publications)
Species: Hu
Applications: IHC, WB
Glutathione
S-Transferase pi 1/GS ...
NBP2-16756
Western Blot Glutathione S-Transferase pi 1/GSTP1 Antibody
Immunocytochemistry/ Immunofluorescence Glutathione S-Transferase pi 1/GSTP1 Antibody
Immunohistochemistry-Paraffin Glutathione S-Transferase pi 1/GSTP1 Antibody
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
QPRT Antibody
(OTI1C10)
NBP2-02860
Flow Cytometry QPRT Antibody (OTI1C10)
Western Blot QPRT Antibody (OTI1C10)
Immunohistochemistry-Paraffin QPRT Antibody (OTI1C10)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Serpin A1/alpha
1-Antitrypsin Antibod ...
MAB1268
Western Blot Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]
Simple Western Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]
Immunocytochemistry Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]
(1 Review)
(13 Publications)
Species: Hu
Applications: ICC, IHC, IP, Simple Western, WB
APRT Antibody
NBP1-89519
Immunohistochemistry-Paraffin APRT Antibody
Immunocytochemistry/ Immunofluorescence APRT Antibody
Western Blot APRT Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PLA, WB
Aminopeptidase
N/CD13 Antibody [Unco ...
AF2335
Immunocytochemistry Aminopeptidase N/CD13 Antibody [Unconjugated]
Immunohistochemistry Aminopeptidase N/CD13 Antibody [Unconjugated]
(57 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
ACMSD Antibody
NBP1-86108
Immunohistochemistry-Paraffin ACMSD Antibody
Immunohistochemistry-Paraffin ACMSD Antibody
Immunohistochemistry-Paraffin ACMSD Antibody
Species: Hu
Applications: IHC, IHC-P, WB
TDO2 Antibody
H00006999-B01P
Western Blot TDO2 Antibody
Knockout Validated TDO2 Antibody
Immunohistochemistry TDO2 Antibody
(7 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
CXCL8/IL-8
Antibody (6217) [Unco ...
MAB208
Neutralization CXCL8/IL-8 Antibody (6217) [Unconjugated]
Immunocytochemistry CXCL8/IL-8 Antibody (6217) [Unconjugated]
Western Blot CXCL8/IL-8 Antibody (6217) [Unconjugated]
(1 Review)
(183 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
alcohol
dehydrogenase 5 Antib
NBP2-49350
Western Blot alcohol dehydrogenase 5 Antibody
Immunohistochemistry-Paraffin alcohol dehydrogenase 5 Antibody
Immunohistochemistry-Paraffin alcohol dehydrogenase 5 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Endoglin/CD105
Antibody [Unconjugate
AF1320
Immunocytochemistry Endoglin/CD105 Antibody [Unconjugated]
Immunocytochemistry Endoglin/CD105 Antibody [Unconjugated]
Simple Western Endoglin/CD105 Antibody [Unconjugated]
(2 Reviews)
(44 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Asparagine
synthetase Antibody
NBP1-87444
Immunohistochemistry-Paraffin Asparagine synthetase Antibody
Immunohistochemistry-Paraffin Asparagine synthetase Antibody
Immunohistochemistry-Paraffin Asparagine synthetase Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
ALDH1L1 Antibody
(2E7)
NBP2-50033
Immunocytochemistry/ Immunofluorescence ALDH1L1 Antibody (2E7)
Western Blot ALDH1L1 Antibody (2E7)
Immunocytochemistry/ Immunofluorescence ALDH1L1 Antibody (2E7)
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB

Publications for NAPRT1 Protein (NBP1-87244PEP) (0)

There are no publications for NAPRT1 Protein (NBP1-87244PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NAPRT1 Protein (NBP1-87244PEP) (0)

There are no reviews for NAPRT1 Protein (NBP1-87244PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NAPRT1 Protein (NBP1-87244PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NAPRT1 Products

Research Areas for NAPRT1 Protein (NBP1-87244PEP)

Find related products by research area.

Blogs on NAPRT1

There are no specific blogs for NAPRT1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NAPRT1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol NAPRT