![Western Blot: NAP1L1 Antibody [NBP1-81162] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)](http://images.novusbio.com/fullsize/NAP1L1-Antibody-Western-Blot-NBP1-81162-img0006.jpg "Western Blot: NAP1L1 Antibody [NBP1-81162] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESLPRVVK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NAP1L1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Theoretical MW | 45 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry Neuropilin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neuropilin1_AF566_Immunohistochemistry_21496.jpg)
![Immunohistochemistry Neuropilin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neuropilin1_AF566_Immunohistochemistry_21497.jpg)
![Western Blot Neuropilin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neuropilin1_AF566_Western_Blot_21557.jpg)
![Neutralization CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/CXCL8_MAB208_Block_Neutralize_9064.jpg)
![Immunocytochemistry CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/CXCL8_MAB208_Immunocytochemistry_9339.jpg)
![Western Blot CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/mab208_human-il-8-cxcl8-mab-clone-6217-western-blot-1882021143847.jpg)
| Publication using NBP1-81162 | Applications | Species |
|---|---|---|
| Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261] |
Secondary Antibodies |
Isotype Controls |
Research Areas for NAP1L1 Antibody (NBP1-81162)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: NAP1L1 Antibody [NBP1-81162] - Staining of human tonsil shows strong cytoplasmic positivity in germinal center cells.](http://images.novusbio.com/fullsize/NAP1L1-Antibody-Immunohistochemistry-Paraffin-NBP1-81162-img0011.jpg "Immunohistochemistry-Paraffin: NAP1L1 Antibody [NBP1-81162] - Staining of human tonsil shows strong cytoplasmic positivity in germinal center cells.")
![Western Blot: NAP1L1 Antibody [NBP1-81162] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://images.novusbio.com/fullsize/NAP1L1-Antibody-Western-Blot-NBP1-81162-img0005.jpg "Western Blot: NAP1L1 Antibody [NBP1-81162] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue")
![Immunohistochemistry-Paraffin: NAP1L1 Antibody [NBP1-81162] - Staining of human fallopian tube shows very strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/NAP1L1-Antibody-Immunohistochemistry-Paraffin-NBP1-81162-img0008.jpg "Immunohistochemistry-Paraffin: NAP1L1 Antibody [NBP1-81162] - Staining of human fallopian tube shows very strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: NAP1L1 Antibody [NBP1-81162] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/NAP1L1-Antibody-Immunohistochemistry-Paraffin-NBP1-81162-img0009.jpg "Immunohistochemistry-Paraffin: NAP1L1 Antibody [NBP1-81162] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: NAP1L1 Antibody [NBP1-81162] - Staining of human liver shows weak cytoplasmic positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/NAP1L1-Antibody-Immunohistochemistry-Paraffin-NBP1-81162-img0010.jpg "Immunohistochemistry-Paraffin: NAP1L1 Antibody [NBP1-81162] - Staining of human liver shows weak cytoplasmic positivity in hepatocytes as expected.")
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![Immunohistochemistry Neuropilin-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neuropilin2_AF567_Immunohistochemistry_16084.jpg)
![Western Blot Neuropilin-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neuropilin2_AF567_Western_Blot_20048.jpg)
![Simple Western Neuropilin-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neuropilin2_AF567_Simple_Western_20049.jpg)
![Western Blot Angiopoietin-like Protein 2/ANGPTL2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Angiopoietinlike_Protein_2_AF1444_Western_Blot_19840.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")