Home » Nanos2 » Nanos2 Peptides and Proteins » Nanos2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Nanos2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Nanos2 Protein (NBP2-13638PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Nanos2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NANOS2.

Source: E. coli

Amino Acid Sequence: MQLPPFDMWKDYFNLSQVVWALIASRGQRLETQEIEEPSPGPPLGQDQGLGAPGANGGLGTLCNFCKHNGESRHVYSSHQLKTPDGVVVCPILRHYVCPVCGATGDQAHTLKYCPLNGGQQSLYRRSGRNSAGRRVKR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NANOS2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13638.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Nanos2 Recombinant Protein Antigen

  • nanos homolog 2 (Drosophila)
  • nanos homolog 2
  • Nanos2
  • NOS2NOS-2

Background

NANOS2 is required to support proliferation and self-renewal of proximal germ cells in males only. Probably regulatestranslation of specific mRNAs by associating with the 3'-UTR of mRNA targets. Essential for spermatogonia formation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

ISYNA1 Antibody
NBP2-47415
Immunocytochemistry/ Immunofluorescence ISYNA1 Antibody
Immunohistochemistry-Paraffin ISYNA1 Antibody
Immunohistochemistry-Paraffin ISYNA1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(818 Publications)
Species: Hu
Applications: BA
nNOS Antibody
NB100-858
Immunocytochemistry/ Immunofluorescence nNOS Antibody
Flow Cytometry nNOS Antibody
Immunocytochemistry/ Immunofluorescence nNOS Antibody
(1 Review)
(15 Publications)
Species: Gp, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
eNOS Antibody -
BSA Free
NB300-500
Western Blot eNOS Antibody - BSA Free
Immunohistochemistry-Paraffin eNOS Antibody - BSA Free
Immunohistochemistry-Paraffin eNOS Antibody - BSA Free
(3 Reviews)
(28 Publications)
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
COX-2 Antibody
NB100-689
Immunohistochemistry-Paraffin COX-2 Antibody
Simple Western COX-2 Antibody
(1 Review)
(36 Publications)
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
Nanos3 Antibody -
BSA Free
NBP1-76919
Immunocytochemistry/ Immunofluorescence Nanos3 Antibody - BSA Free
Western Blot Nanos3 Antibody - BSA Free
Immunohistochemistry-Paraffin Nanos3 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
IFN-gamma
[Unconjugated]
285-IF
Bioactivity IFN-gamma [Unconjugated]
SDS-PAGE IFN-gamma [Unconjugated]
SEC-MALS IFN-gamma [Unconjugated]
(2 Reviews)
(454 Publications)
Species: Hu
Applications: BA
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(664 Publications)
Species: Mu
Applications: ELISA
NANOS1 Antibody
NBP2-27084
Immunohistochemistry-Paraffin NANOS1 Antibody
Species: Hu, Pm
Applications: IHC, IHC-P, WB
IL-10 [Biotin]
DY417
N/A IL-10 [Biotin]
(302 Publications)
Species: Mu
Applications: ELISA
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB

Myeloperoxidase/MPO An ...
AF3667
Western Blot Myeloperoxidase/MPO Antibody [Unconjugated]
Simple Western Myeloperoxidase/MPO Antibody [Unconjugated]
Immunocytochemistry Myeloperoxidase/MPO Antibody [Unconjugated]
(3 Reviews)
(167 Publications)
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
HO-1/HMOX1/HSP32
Antibody (HO-1-1)
NBP1-97507
Flow Cytometry HO-1/HMOX1/HSP32 Antibody (HO-1-1)
Immunohistochemistry-Paraffin HO-1/HMOX1/HSP32 Antibody (HO-1-1)
Western Blot HO-1/HMOX1/HSP32 Antibody (HO-1-1)
(1 Review)
(20 Publications)
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
IL-1 beta/IL-1F2
[Unconjugated]
201-LB
SDS-PAGE IL-1 beta/IL-1F2 [Unconjugated]
Bioactivity IL-1 beta/IL-1F2 [Unconjugated]
SEC-MALS IL-1 beta/IL-1F2 [Unconjugated]
(595 Publications)
Species: Hu
Applications: BA
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB

Publications for Nanos2 Protein (NBP2-13638PEP) (0)

There are no publications for Nanos2 Protein (NBP2-13638PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nanos2 Protein (NBP2-13638PEP) (0)

There are no reviews for Nanos2 Protein (NBP2-13638PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Nanos2 Protein (NBP2-13638PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Nanos2 Products

Array NBP2-13638PEP

Research Areas for Nanos2 Protein (NBP2-13638PEP)

Find related products by research area.

Blogs on Nanos2

There are no specific blogs for Nanos2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Nanos2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol NANOS2