Home » Myocilin » Myocilin Proteins » Myocilin Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Myocilin Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Myocilin Protein (NBP1-89769PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Myocilin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MYOC.

Source: E. coli

Amino Acid Sequence: NLLRDKSVLEEEKKRLRQENENLARRLESSSQEVARLRRGQCPQTRDTARAVPPGSREVSTWNLDTLAFQELKSELTEVPASRIL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MYOC
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89769.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Myocilin Recombinant Protein Antigen

  • GLC1A
  • GLC1Amyocilin
  • GPOA
  • JOAG
  • JOAG1
  • MYOC
  • Myocilin
  • myocilin, trabecular meshwork inducible glucocorticoid response
  • TIGR
  • TIGRmutated trabecular meshwork-induced glucocorticoid response protein
  • Trabecular meshwork-induced glucocorticoid response protein

Background

MYOC encodes the protein myocilin, which is believed to have a role in cytoskeletal function. MYOC is expressed in many occular tissues, including the trabecular meshwork, and was revealed to be the trabecular meshwork glucocorticoid-inducible response protein (TIGR). The trabecular meshwork is a specialized eye tissue essential in regulating intraocular pressure, and mutations in MYOC have been identified as the cause of hereditary juvenile-onset open-angle glaucoma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Optineurin Antibody
NBP1-84682
Western Blot Optineurin Antibody
Western Blot Optineurin Antibody
Western Blot Optineurin Antibody
(2 Reviews)
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
CYP1B1 Antibody
NBP2-24722
Immunohistochemistry-Paraffin CYP1B1 Antibody
Western Blot CYP1B1 Antibody
Immunohistochemistry-Paraffin CYP1B1 Antibody
(1 Review)
(5 Publications)
Species: Hu
Applications: IHC, IHC-P, In vitro, WB
WDR36 Antibody
(1D6)
H00134430-M01
Sandwich ELISA WDR36 Antibody (1D6)
(3 Publications)
Species: Ch, Hu, Pm, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Fibronectin
Antibody - BSA Free
NBP1-91258
Western Blot Fibronectin Antibody - BSA Free
Western Blot Fibronectin Antibody - BSA Free
Western Blot Fibronectin Antibody - BSA Free
(11 Reviews)
(56 Publications)
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
GR/NR3C1 Antibody
(BuGR2) - BSA Free
NB300-731
Flow Cytometry GR/NR3C1 Antibody (BuGR2) - BSA Free
Flow Cytometry GR/NR3C1 Antibody (BuGR2) - BSA Free
Immunocytochemistry/ Immunofluorescence GR/NR3C1 Antibody (BuGR2) - BSA Free
(3 Reviews)
(12 Publications)
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
Apolipoprotein
E/ApoE Antibody (WUE- ...
NB110-60531
Flow (Intracellular) Apolipoprotein E/ApoE Antibody (WUE-4) - BSA Free
Western Blot Apolipoprotein E/ApoE Antibody (WUE-4) - BSA Free
Flow Cytometry Apolipoprotein E/ApoE Antibody (WUE-4) - BSA Free
(2 Reviews)
(38 Publications)
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
GRP78/HSPA5
Antibody - BSA Free
NBP1-06274
Flow Cytometry GRP78/HSPA5 Antibody - BSA Free
Flow Cytometry GRP78/HSPA5 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence GRP78/HSPA5 Antibody - BSA Free
(2 Reviews)
(43 Publications)
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB
Optimedin Antibody
(3A2)
H00118427-M06
ELISA Optimedin Antibody (3A2)
Western Blot Optimedin Antibody (3A2)
Western Blot Optimedin Antibody (3A2)
Species: Hu, Mu, Rt
Applications: ELISA, WB
PITX2 Antibody
[Unconjugated]
AF7388
Immunohistochemistry PITX2 Antibody [Unconjugated]
(8 Publications)
Species: Hu
Applications: IHC
NT-4 [Unconjugated]
268-N4/CF
NT-4 [Unconjugated]
(9 Publications)
Species: Hu
Applications: BA
Frizzled-4
Antibody (145901)
MAB194
Frizzled-4 Antibody (145901)
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
SPARC Antibody
[Unconjugated]
AF942
Western Blot SPARC Antibody [Unconjugated]
Immunohistochemistry SPARC Antibody [Unconjugated]
Immunocytochemistry SPARC Antibody [Unconjugated]
(38 Publications)
Species: Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow, WB

Olfactomedin-2/Noelin- ...
AF5614
Western Blot Olfactomedin-2/Noelin-2 Antibody [Unconjugated]
Species: Hu
Applications: WB
FoxC1 Antibody
NB100-1268
Flow Cytometry FoxC1 Antibody
Immunocytochemistry/ Immunofluorescence FoxC1 Antibody
Immunohistochemistry FoxC1 Antibody
(12 Publications)
Species: Hu, Mu, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, KD, KO, PEP-ELISA, WB

Olfactomedin-1/Noelin-
AF4636
Olfactomedin-1/Noelin-1 Antibody
(4 Publications)
Species: Mu
Applications: WB
Glutathione
Reductase Antibody
NBP2-16684
Western Blot Glutathione Reductase Antibody
Western Blot Glutathione Reductase Antibody
Western Blot Glutathione Reductase Antibody
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Decorin Antibody
[Unconjugated]
AF143
Western Blot Decorin Antibody [Unconjugated]
Simple Western Decorin Antibody [Unconjugated]
Immunohistochemistry Decorin Antibody [Unconjugated]
(29 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
Integrin alpha
2b/CD41 Antibody (745 ...
MAB7616
Western Blot Integrin alpha 2b/CD41 Antibody (745201) [Unconjugated]
Flow Cytometry Integrin alpha 2b/CD41 Antibody (745201) [Unconjugated]
Flow Cytometry Integrin alpha 2b/CD41 Antibody (745201) [Unconjugated]
(6 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, WB
FABP6 Antibody
[Unconjugated]
AF3880
Immunocytochemistry FABP6 Antibody [Unconjugated]
(2 Publications)
Species: Hu
Applications: ICC, WB
Myocilin
Recombinant Protein A
NBP1-89769PEP
Myocilin Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Myocilin Protein (NBP1-89769PEP) (0)

There are no publications for Myocilin Protein (NBP1-89769PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Myocilin Protein (NBP1-89769PEP) (0)

There are no reviews for Myocilin Protein (NBP1-89769PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Myocilin Protein (NBP1-89769PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Myocilin Products

Research Areas for Myocilin Protein (NBP1-89769PEP)

Find related products by research area.

Blogs on Myocilin

There are no specific blogs for Myocilin, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western Blot: Fibronectin Antibody - BSA Free [NBP1-91258] - Nicotinamide (NAM) attenuates unilateral urethral obstruction (UUO)-induced renal interstitial fibrosis. C57BL/6 mice were subjected to UUO surgery or sham operation. Different doses of NAM or saline were intraperitoneally injected an hour before the surgery and daily thereafter. Representative images of Western blot of FN (fibronectin), alpha-SMA (alpha-smooth muscle actin) and GAPDH (loading control). Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30993884/) licensed under a CC-BY license.
Fibronectin Antibody - BSA Free
NBP1-91258
Myocilin was detected in immersion fixed paraffin-embedded sections of Human Skeletal Muscle using Mouse Anti-Human Myocilin Monoclonal Antibody (Catalog # MAB3446) at 5 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using VisUCyte Antigen Retrieval Reagent-Basic (Catalog # VCTS021). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to sarcoplasm and sarcolemma in skeletal muscle cells. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
Myocilin Antibody (297817) [Unconjugated]
MAB3446
Flow Cytometry: GRP78/HSPA5 Antibody [NBP1-06274] - An intracellular stain was performed on Jurkat cells with Alexa Fluor 647 conjugate of GPR78/HSPA5 antibody NBP1-06274AF647 (blue) and a matched isotype control NBP2-24893AF647 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
GRP78/HSPA5 Antibody - BSA Free
NBP1-06274

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Myocilin Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol MYOC