![Western Blot: Myelin expression factor 2 Antibody [NBP2-93986] - Analysis of extracts of various cell lines, using Myelin expression factor 2 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 30s.](http://images.novusbio.com/fullsize/Myelin-expression-factor-2-Antibody-Western-Blot-NBP2-93986-img0002.jpg "Western Blot: Myelin expression factor 2 Antibody [NBP2-93986] - Analysis of extracts of various cell lines, using Myelin expression factor 2 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 30s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human MYEF2 (NP_001288139.1). MADANKAEVPGATGGDSPHLQPAEPPGEPRREPHPAEAEKQQPQHSSSSNGVKMENDESAKEEKSDLKEKSTGSKKANRFHPYSKDKNSGTGEKKGPNRNRVFISNIPYDMKWQAIKDLM |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MYEF2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.01% Thimerosal |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MYEF2 |
![Immunocytochemistry/Immunofluorescence: Myelin expression factor 2 Antibody [NBP2-93986] - Analysis of C6 cells using Myelin expression factor 2 at dilution of 1:100. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/Myelin-expression-factor-2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-93986-img0001.jpg "Immunocytochemistry/Immunofluorescence: Myelin expression factor 2 Antibody [NBP2-93986] - Analysis of C6 cells using Myelin expression factor 2 at dilution of 1:100. Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: Myelin expression factor 2 Antibody [NBP2-93986] - Human liver cancer using MYEF2 Rabbit pAb at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/Myelin-expression-factor-2-Antibody-Immunohistochemistry-Paraffin-NBP2-93986-img0005.jpg "Immunohistochemistry-Paraffin: Myelin expression factor 2 Antibody [NBP2-93986] - Human liver cancer using MYEF2 Rabbit pAb at dilution of 1:100 (40x lens).")
![Immunohistochemistry-Paraffin: Myelin expression factor 2 Antibody [NBP2-93986] - Mouse brain using MYEF2 Rabbit pAb at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/Myelin-expression-factor-2-Antibody-Immunohistochemistry-Paraffin-NBP2-93986-img0003.jpg "Immunohistochemistry-Paraffin: Myelin expression factor 2 Antibody [NBP2-93986] - Mouse brain using MYEF2 Rabbit pAb at dilution of 1:100 (40x lens).")
![Immunohistochemistry-Paraffin: Myelin expression factor 2 Antibody [NBP2-93986] - Rat testis using MYEF2 Rabbit pAb at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/Myelin-expression-factor-2-Antibody-Immunohistochemistry-Paraffin-NBP2-93986-img0004.jpg "Immunohistochemistry-Paraffin: Myelin expression factor 2 Antibody [NBP2-93986] - Rat testis using MYEF2 Rabbit pAb at dilution of 1:100 (40x lens).")
![N/A PSG1 [HRP]](https://images.novusbio.com/images2/DATA_PSG1_DPSG10_ELISA_797.jpg)
![N/A PSG1 [HRP]](https://images.novusbio.com/images2/PSG-1_DPSG10_ELISA_164.jpg)
![Western Blot NKX2.5 Antibody [Unconjugated]](https://images.novusbio.com/images/af2444_human-nkx2-5-affinity-purified-polyclonal-ab-4120241239327.jpg)
![Immunocytochemistry/ Immunofluorescence NKX2.5 Antibody [Unconjugated]](https://images.novusbio.com/images/af2444_human-nkx2-5-affinity-purified-polyclonal-ab-41202412401270.jpg)
![Immunocytochemistry/ Immunofluorescence NKX2.5 Antibody [Unconjugated]](https://images.novusbio.com/images/af2444_human-nkx2-5-affinity-purified-polyclonal-ab-41202412403531.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")