![Western Blot: Myelin expression factor 2 Antibody [NBP2-87864] - Host: Mouse. Target Name: MYEF2. Sample Tissue: Mouse Testis. Antibody Dilution: 1ug/ml](http://images.novusbio.com/fullsize/Myelin-expression-factor-2-Antibody-Western-Blot-NBP2-87864-img0003.jpg "Western Blot: Myelin expression factor 2 Antibody [NBP2-87864] - Host: Mouse. Target Name: MYEF2. Sample Tissue: Mouse Testis. Antibody Dilution: 1ug/ml")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human Myelin expression factor 2. Peptide sequence: QAGRLGSTIFVANLDFKVGWKKLKEVFSIAGTVKRADIKEDKDGKSRGMG The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MYEF2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MYEF2 |
![Immunohistochemistry-Paraffin: Myelin expression factor 2 Antibody [NBP2-87864] - Rabbit Anti-MYEF2 Antibody. Paraffin Embedded Tissue: Human alveolar cell. Cellular Data: Epithelial cells of renal tubule. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X](http://images.novusbio.com/fullsize/Myelin-expression-factor-2-Antibody-Immunohistochemistry-Paraffin-NBP2-87864-img0002.jpg "Immunohistochemistry-Paraffin: Myelin expression factor 2 Antibody [NBP2-87864] - Rabbit Anti-MYEF2 Antibody. Paraffin Embedded Tissue: Human alveolar cell. Cellular Data: Epithelial cells of renal tubule. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X")
![Western Blot: Myelin expression factor 2 Antibody [NBP2-87864] - Host: Rabbit. Target Name: MYEF2. Sample Tissue: Human 786-0. Antibody Dilution: 1.0ug/ml](http://images.novusbio.com/fullsize/Myelin-expression-factor-2-Antibody-Western-Blot-NBP2-87864-img0004.jpg "Western Blot: Myelin expression factor 2 Antibody [NBP2-87864] - Host: Rabbit. Target Name: MYEF2. Sample Tissue: Human 786-0. Antibody Dilution: 1.0ug/ml")
![Immunohistochemistry: Myelin expression factor 2 Antibody [NBP2-87864] - Human Lung](http://images.novusbio.com/fullsize/Myelin-expression-factor-2-Antibody-Immunohistochemistry-NBP2-87864-img0001.jpg "Immunohistochemistry: Myelin expression factor 2 Antibody [NBP2-87864] - Human Lung")
![N/A PSG1 [HRP]](https://images.novusbio.com/images2/DATA_PSG1_DPSG10_ELISA_797.jpg)
![N/A PSG1 [HRP]](https://images.novusbio.com/images2/PSG-1_DPSG10_ELISA_164.jpg)
![Western Blot NKX2.5 Antibody [Unconjugated]](https://images.novusbio.com/images/af2444_human-nkx2-5-affinity-purified-polyclonal-ab-4120241239327.jpg)
![Immunocytochemistry/ Immunofluorescence NKX2.5 Antibody [Unconjugated]](https://images.novusbio.com/images/af2444_human-nkx2-5-affinity-purified-polyclonal-ab-41202412401270.jpg)
![Immunocytochemistry/ Immunofluorescence NKX2.5 Antibody [Unconjugated]](https://images.novusbio.com/images/af2444_human-nkx2-5-affinity-purified-polyclonal-ab-41202412403531.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")