Reactivity | Hu, RtSpecies Glossary |
Applications | WB, IHC |
Clone | 5J3R7 |
Clonality | Monoclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Additional Information | Recombinant Monoclonal Antibody |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 4807-4916 of human MUC4 (Q99102). WATVSVIALSNILHASASLPPEYQNRTEGLLGVWNNNPEDDFRMPNGSTIPPGSPEEMLFHFGMTWQINGTGLLGKRNDQLPSNFTPVFYSQLQKNSSWAEHLISNCDGD |
Isotype | IgG |
Clonality | Monoclonal |
Host | Rabbit |
Gene | MUC4 |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
Preservative | 0.02% Sodium Azide |
Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for MUC4 Antibody (NBP3-16186)Find related products by research area.
|
MUC4 (Mucin-4) Mucus is the viscous secretion that covers epithelial surfaces (trachea, colon, and cervix) and consists of twenty highly glycosylated proteins called mucins. The mucin family all are high-molecular weight proteins with oligosaccharides attached to th... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | MUC4 |