Home » MTP18 » MTP18 Proteins » MTP18 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

MTP18 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for MTP18 Recombinant Protein Antigen (NBP2-57803PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

MTP18 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MTP18.

Source: E. coli

Amino Acid Sequence: CFMSTSYSCQGMWTPGSLVSKDPGTWVGLSWTEA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MTFP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57803.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MTP18 Recombinant Protein Antigen

  • HSPC242
  • Mitochondrial 18 kDa protein
  • mitochondrial fission process 1
  • mitochondrial fission process protein 1
  • mitochondrial protein 18 kDa
  • MTP18mitochondrial fission protein MTP18

Background

MTP18 is a mitochondrial protein and downstream target of the phosphatidylinositol 3-kinase (see PIK3CA, MIM 171834) signaling pathway that plays a role in cell viability and mitochondrial dynamics (Tondera et al., 2004 [PubMed 15155745]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PINK1 Antibody -
BSA Free
BC100-494
Western Blot PINK1 Antibody - BSA Free
Western Blot PINK1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PINK1 Antibody - BSA Free
(13 Reviews)
(277 Publications)
Species: Hu, Mu, Rb, Rt
Applications: EM, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PEP-ELISA, PAGE, WB
Properdin Antibody
AF8216
Western Blot Properdin Antibody
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB
SDHA Antibody
(GT20710)
NBP3-13522
Western Blot SDHA Antibody (GT20710)
Western Blot SDHA Antibody (GT20710)
Immunocytochemistry/ Immunofluorescence SDHA Antibody (GT20710)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PTGFR Antibody -
BSA Free
NLS1049
Unknown PTGFR Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PTGFR Antibody - BSA Free
Western Blot PTGFR Antibody - BSA Free
(2 Publications)
Species: Eq, Hu, Pm, Po, Pm
Applications: ICC, ICC/IF, IHC, IHC-P
TTC11 Antibody
NBP1-85664
Immunohistochemistry-Paraffin TTC11 Antibody
Immunocytochemistry/ Immunofluorescence TTC11 Antibody
Immunohistochemistry-Paraffin TTC11 Antibody
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
DRP1 Antibody -
BSA Free
NB110-55288
Flow Cytometry DRP1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence DRP1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence DRP1 Antibody - BSA Free
(3 Reviews)
(48 Publications)
Species: Fi, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
LIGHT/TNFSF14
[Unconjugated]
664-LI
SDS-PAGE LIGHT/TNFSF14 [Unconjugated]
Bioactivity LIGHT/TNFSF14 [Unconjugated]
(21 Publications)
Species: Hu
Applications: BA
DAP Kinase 2
Antibody (OTI1C5)
NBP2-02477
Flow Cytometry DAP Kinase 2 Antibody (OTI1C5)
Flow Cytometry DAP Kinase 2 Antibody (OTI1C5)
Immunocytochemistry/ Immunofluorescence DAP Kinase 2 Antibody (OTI1C5)
(2 Publications)
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
HRAS Antibody
NBP2-42864
Western Blot HRAS Antibody
Western Blot HRAS Antibody
Western Blot HRAS Antibody
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Peroxiredoxin 2
Antibody (4E10-2D2)
H00007001-M01
ELISA Peroxiredoxin 2 Antibody (4E10-2D2)
Knockdown Validated Peroxiredoxin 2 Antibody (4E10-2D2)
Western Blot Peroxiredoxin 2 Antibody (4E10-2D2)
(1 Review)
(6 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
Utrophin Antibody
(5G6)
H00007402-M01
ELISA Utrophin Antibody (5G6)
Immunocytochemistry/ Immunofluorescence Utrophin Antibody (5G6)
Species: Hu
Applications: ELISA, ICC/IF, WB
Mitofusin 1
Antibody (3C9)
H00055669-M04
Western Blot Mitofusin 1 Antibody (3C9)
Western Blot Mitofusin 1 Antibody (3C9)
Western Blot Mitofusin 1 Antibody (3C9)
(33 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IP, KD, WB
HIST1H4F
Overexpression Lysate
NBP2-07996
Western Blot HIST1H4F Overexpression Lysate
Species: Hu
Applications: WB
H4/e
Overexpression Lysate
NBL1-11570
Western Blot H4/e Overexpression Lysate
Species: Hu
Applications: WB
Recombinant Human
HIST1H4I GST (N-Term) ...
H00008294-P01
SDS-PAGE Recombinant Human HIST1H4I GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Histone H4 Antibody
AF5215
Western Blot Histone H4 Antibody
Immunocytochemistry Histone H4 Antibody
(6 Publications)
Species: Hu, Mu
Applications: ICC, WB
H4/h Antibody (6D4)
H00008365-M01
Sandwich ELISA H4/h Antibody (6D4)
Immunocytochemistry/ Immunofluorescence H4/h Antibody (6D4)
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA
MTP18 Recombinant
Protein Antigen
NBP2-57803PEP
MTP18 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for MTP18 Recombinant Protein Antigen (NBP2-57803PEP) (0)

There are no publications for MTP18 Recombinant Protein Antigen (NBP2-57803PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MTP18 Recombinant Protein Antigen (NBP2-57803PEP) (0)

There are no reviews for MTP18 Recombinant Protein Antigen (NBP2-57803PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MTP18 Recombinant Protein Antigen (NBP2-57803PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MTP18 Products

Array NBP2-57803PEP

Research Areas for MTP18 Recombinant Protein Antigen (NBP2-57803PEP)

Find related products by research area.

Blogs on MTP18

There are no specific blogs for MTP18, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western blot image of PINK1 antibody (BC100-494) in multiple cells lines. Human HeLa (lane 1), Mouse NIH-3T3 (lane 2), L929 (lane 3) and Rat PC12 (lane 4) whole cell protein were separated by SDS-PAGE on a 7.5% polyacrylamide gel. Protein was transferred to PVDF membrane and probed with 2 ug/mL BC100-494 in 1% BSA and detected with an HRP-conjugated anti-rabbit secondary antibody using chemiluminescence. Observed molecular weight ~55 kDa (arrowhead).
PINK1 Antibody - BSA Free
BC100-494
Flow Cytometry: DRP1 Antibody [NB110-55288] - An intracellular stain was performed on HeLa cells with NB110-55288 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 550.
DRP1 Antibody - BSA Free
NB110-55288

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MTP18 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol MTFP1