![Western Blot: MTP18 Antibody [H00051537-B01P] - Analysis of MTP18 expression in human liver.](http://images.novusbio.com/fullsize/MTP18-Antibody-Western-Blot-H00051537-B01P-img0003.jpg "Western Blot: MTP18 Antibody [H00051537-B01P] - Analysis of MTP18 expression in human liver.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | MTP18 (NP_057582.2, 1 a.a. - 166 a.a.) full-length human protein. MSEPQPRGAERDLYRDTWVRYLGYANEVGEAFRSLVPAAVVWLSYGVASSYVLADAIDKGKKAGEVPSPEAGRSARVTVAVVDTFVWQALASVAIPGFTINRVCAASLYVLGTATRWPLAVRKWTTTALGLLTIPIIIHPIDRSVDFLLDSSLRKLYPTVGKPSSS |
| Specificity | MTP18 - mitochondrial protein 18 kDa, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | MTFP1 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for MTP18 Antibody (H00051537-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MTFP1 |
| Entrez |
|
| Uniprot |
|
![Western Blot: MTP18 Antibody [H00051537-B01P] - Analysis of MTP18 expression in transfected 293T cell line by MTP18 polyclonal antibody. Lane 1: MTP18 transfected lysate(18.26 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/MTP18-Antibody-Western-Blot-H00051537-B01P-img0004.jpg "Western Blot: MTP18 Antibody [H00051537-B01P] - Analysis of MTP18 expression in transfected 293T cell line by MTP18 polyclonal antibody. Lane 1: MTP18 transfected lysate(18.26 KDa). Lane 2: Non-transfected lysate.")
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")