![Immunocytochemistry/Immunofluorescence: MRRF Antibody [NBP2-33586] - Immunofluorescent staining of human cell line HEK 293 shows localization to microtubules & cytokinetic bridge. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/MRRF-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-33586-img0003.jpg "Immunocytochemistry/Immunofluorescence: MRRF Antibody [NBP2-33586] - Immunofluorescent staining of human cell line HEK 293 shows localization to microtubules & cytokinetic bridge. Antibody staining is shown in green.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EALKDNFNKTLNIRTSPGSLDKIAVVTADGKLALNQISQISMKSPQLILVNMASFPECTAAAIKAIRESGMNLNPEVEGTLI |
| Predicted Species | Mouse (93%), Rat (95%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MRRF |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
![Immunohistochemistry PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Immunohistochemistry_16650.jpg)
![Western Blot PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Western_Blot_16656.jpg)
![Immunohistochemistry ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Immunohistochemistry_6703.jpg)
![Western Blot ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Flow_Cytometry_20028.jpg)
![Simple Western ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Simple_Western_20109.jpg)
| Publication using NBP2-33586 | Applications | Species |
|---|---|---|
| Park S, Dahn R, Kurt E et al. The mammalian midbody and midbody remnant are assembly sites for RNA and localized translation Developmental cell 2023-08-07 [PMID: 37552987] |
Secondary Antibodies |
Isotype Controls |
Research Areas for MRRF Antibody (NBP2-33586)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: MRRF Antibody [NBP2-33586] - Staining of human parathyroid gland shows high expression.](http://images.novusbio.com/fullsize/MRRF-Antibody-Immunohistochemistry-Paraffin-NBP2-33586-img0008.jpg "Immunohistochemistry-Paraffin: MRRF Antibody [NBP2-33586] - Staining of human parathyroid gland shows high expression.")
![Immunohistochemistry-Paraffin: MRRF Antibody [NBP2-33586] - Analysis in human parathyroid gland and pancreas tissues using Anti-MRRF antibody. Corresponding MRRF RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/MRRF-Antibody-Immunohistochemistry-Paraffin-NBP2-33586-img0006.jpg "Immunohistochemistry-Paraffin: MRRF Antibody [NBP2-33586] - Analysis in human parathyroid gland and pancreas tissues using Anti-MRRF antibody. Corresponding MRRF RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: MRRF Antibody [NBP2-33586] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/MRRF-Antibody-Immunohistochemistry-Paraffin-NBP2-33586-img0007.jpg "Immunohistochemistry-Paraffin: MRRF Antibody [NBP2-33586] - Staining of human pancreas shows low expression as expected.")
![N/A C-Reactive Protein/CRP [Biotin]](https://images.novusbio.com/images2/DATA_CReactive_Protein_DY1707_ELISA_1701.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![N/A Cystatin C [HRP]](https://images.novusbio.com/images2/Cystatin_C_MSCTC0_ELISA_321.jpg)
![N/A Cystatin C [HRP]](https://images.novusbio.com/images2/Cystatin_C_MSCTC0_ELISA_322.jpg)
![N/A Cystatin C [HRP]](https://images.novusbio.com/images2/DATA_Cystatin_C_MSCTC0_ELISA_1030.jpg)
![Immunohistochemistry CD55/DAF Antibody [Unconjugated]](https://images.novusbio.com/images2/CD55_AF2009_Immunohistochemistry_6728.jpg)
![Immunocytochemistry CD55/DAF Antibody [Unconjugated]](https://images.novusbio.com/images2/CD55_AF2009_Immunocytochemistry__Immunofluorescence_23052.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")