![Immunocytochemistry/Immunofluorescence: mpp8 Antibody [NBP1-92136] - Staining of human cell line U-251 MG shows localization to nucleoplasm and cytosol.](http://images.novusbio.com/fullsize/mpp8-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92136-img0012.jpg "Immunocytochemistry/Immunofluorescence: mpp8 Antibody [NBP1-92136] - Staining of human cell line U-251 MG shows localization to nucleoplasm and cytosol.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KRHDSDKEEKGRKEPKGLKTLKEIRNAFDLFKLTPEEKNDVSENNRKREEIPLDFKTIDDHKTKENKQSLKERRNTRDETDTWAYIAAEGDQEVLDSVCQADENSDGR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MPHOSPH8 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_15885.jpg)
![Immunohistochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunohistochemistry_15886.jpg)
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_16572.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for mpp8 Antibody (NBP1-92136)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MPHOSPH8 |
![Immunohistochemistry-Paraffin: mpp8 Antibody [NBP1-92136] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/mpp8-Antibody-Immunohistochemistry-Paraffin-NBP1-92136-img0023.jpg "Immunohistochemistry-Paraffin: mpp8 Antibody [NBP1-92136] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: mpp8 Antibody [NBP1-92136] - Staining of human colon shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/mpp8-Antibody-Immunohistochemistry-Paraffin-NBP1-92136-img0008.jpg "Immunohistochemistry-Paraffin: mpp8 Antibody [NBP1-92136] - Staining of human colon shows strong nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: mpp8 Antibody [NBP1-92136] - Staining of human liver shows low expression as expected.](http://images.novusbio.com/fullsize/mpp8-Antibody-Immunohistochemistry-Paraffin-NBP1-92136-img0009.jpg "Immunohistochemistry-Paraffin: mpp8 Antibody [NBP1-92136] - Staining of human liver shows low expression as expected.")
![Immunohistochemistry-Paraffin: mpp8 Antibody [NBP1-92136] - Staining of human thyroid gland shows high expression.](http://images.novusbio.com/fullsize/mpp8-Antibody-Immunohistochemistry-Paraffin-NBP1-92136-img0010.jpg "Immunohistochemistry-Paraffin: mpp8 Antibody [NBP1-92136] - Staining of human thyroid gland shows high expression.")
![Immunohistochemistry-Paraffin: mpp8 Antibody [NBP1-92136] - Staining in human thyroid gland and liver tissues using anti-MPHOSPH8 antibody. Corresponding MPHOSPH8 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/mpp8-Antibody-Immunohistochemistry-Paraffin-NBP1-92136-img0011.jpg "Immunohistochemistry-Paraffin: mpp8 Antibody [NBP1-92136] - Staining in human thyroid gland and liver tissues using anti-MPHOSPH8 antibody. Corresponding MPHOSPH8 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: mpp8 Antibody [NBP1-92136] - Staining of human lymph node.](http://images.novusbio.com/fullsize/mpp8-Antibody-Immunohistochemistry-Paraffin-NBP1-92136-img0014.jpg "Immunohistochemistry-Paraffin: mpp8 Antibody [NBP1-92136] - Staining of human lymph node.")
![Immunohistochemistry-Paraffin: mpp8 Antibody [NBP1-92136] - Staining of human kidney.](http://images.novusbio.com/fullsize/mpp8-Antibody-Immunohistochemistry-Paraffin-NBP1-92136-img0015.jpg "Immunohistochemistry-Paraffin: mpp8 Antibody [NBP1-92136] - Staining of human kidney.")
![Immunohistochemistry-Paraffin: mpp8 Antibody [NBP1-92136] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/mpp8-Antibody-Immunohistochemistry-Paraffin-NBP1-92136-img0016.jpg "Immunohistochemistry-Paraffin: mpp8 Antibody [NBP1-92136] - Staining of human cerebral cortex.")
![Immunohistochemistry-Paraffin: mpp8 Antibody [NBP1-92136] - Staining of human testis.](http://images.novusbio.com/fullsize/mpp8-Antibody-Immunohistochemistry-Paraffin-NBP1-92136-img0017.jpg "Immunohistochemistry-Paraffin: mpp8 Antibody [NBP1-92136] - Staining of human testis.")
![Immunohistochemistry-Paraffin: mpp8 Antibody [NBP1-92136] - Staining of human cerebral cortex shows strong nuclear positivity in glial cells.](http://images.novusbio.com/fullsize/mpp8-Antibody-Immunohistochemistry-Paraffin-NBP1-92136-img0018.jpg "Immunohistochemistry-Paraffin: mpp8 Antibody [NBP1-92136] - Staining of human cerebral cortex shows strong nuclear positivity in glial cells.")
![Immunohistochemistry-Paraffin: mpp8 Antibody [NBP1-92136] - Staining of human cerebral cortex, endometrium, kidney and testis using Anti-mpp8 antibody NBP1-92136 (A) shows similar protein distribution across tissues to independent antibody NBP1-92135 (B).](http://images.novusbio.com/fullsize/mpp8-Antibody-Immunohistochemistry-Paraffin-NBP1-92136-img0020.jpg "Immunohistochemistry-Paraffin: mpp8 Antibody [NBP1-92136] - Staining of human cerebral cortex, endometrium, kidney and testis using Anti-mpp8 antibody NBP1-92136 (A) shows similar protein distribution across tissues to independent antibody NBP1-92135 (B).")
![Immunohistochemistry-Paraffin: mpp8 Antibody [NBP1-92136] - Staining of human endometrium shows moderate nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/mpp8-Antibody-Immunohistochemistry-Paraffin-NBP1-92136-img0021.jpg "Immunohistochemistry-Paraffin: mpp8 Antibody [NBP1-92136] - Staining of human endometrium shows moderate nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: mpp8 Antibody [NBP1-92136] - Staining of human kidney shows moderate to strong nuclear positivity in cells in tubules.](http://images.novusbio.com/fullsize/mpp8-Antibody-Immunohistochemistry-Paraffin-NBP1-92136-img0022.jpg "Immunohistochemistry-Paraffin: mpp8 Antibody [NBP1-92136] - Staining of human kidney shows moderate to strong nuclear positivity in cells in tubules.")
![GLP/EHMT1 Antibody (B0422) [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "GLP/EHMT1 Antibody (B0422) [Unconjugated]")
![Western Blot G9a/EHMT2 Antibody (A8620A) [Unconjugated]](https://images.novusbio.com/images/pp-a8620a-00_human-mouse-g9a-ehmt2-mab-clone-a8620a-4120241252118.jpg)
![Immunohistochemistry G9a/EHMT2 Antibody (A8620A) [Unconjugated]](https://images.novusbio.com/images/pp-a8620a-00_human-mouse-g9a-ehmt2-mab-clone-a8620a-412024125214.jpg)
![Immunohistochemistry G9a/EHMT2 Antibody (A8620A) [Unconjugated]](https://images.novusbio.com/images/pp-a8620a-00_human-mouse-g9a-ehmt2-mab-clone-a8620a-4120241251265.jpg)
![N/A alpha-Defensin 1 [Biotin]](https://images.novusbio.com/images2/DATA_alphaDefensin_1_DY819805_ELISA_2534.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")