MMP28 Antibody Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of human MMP28 (NP_116568.1). Peptide sequence LDAQPAERGGQELRKEAEAFLEKYGYLNEQVPKAPTSTRFSDAIRAFQWV |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
MMP28 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Theoretical MW |
43 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for MMP28 Antibody
Background
MMP28 (matrix metallopeptidase 28), can degrade casein and belongs to the MMP family which are part of the metzincin superfamily of proteases. This protein is regulated by interferon alpha, MAPK1, TNF and ethylenediaminetetraacetic acid and is involved in calcium, zinc, and metal ion binding. Studies are currently being performed on the relationship of MMP28 protein to arthritis, various types of carcinoma, encephalomyelitis and multiple sclerosis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: WB
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: ELISA
Species: Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu
Applications: IHC, IP, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: InhibAct
Species: Hu
Applications: IHC, IP, WB
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Publications for MMP28 Antibody (NBP3-09440) (0)
There are no publications for MMP28 Antibody (NBP3-09440).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MMP28 Antibody (NBP3-09440) (0)
There are no reviews for MMP28 Antibody (NBP3-09440).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MMP28 Antibody (NBP3-09440) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MMP28 Products
Research Areas for MMP28 Antibody (NBP3-09440)
Find related products by research area.
|
Blogs on MMP28