MMP20 Antibody Summary
Immunogen |
MMP20 (NP_004762.2, 1 a.a. - 483 a.a.) full-length human protein. MKVLPASGLAVFLIMALKFSTAAPSLVAASPRTWRNNYRLAQAYLDKYYTNKEGHQIGEMVARGSNSMIRKIKELQAFFGLQVTGKLDQTTMNVIKKPRCGVPDVANYRLFPGEPKWKKNTLTYRISKYTPSMSSVEVDKAVEMALQAWSSAVPLSFVRINSGEADIMISFENGDHGDSYPFDGPRGTLAHAFAPGEGLGGDTHFDNAEKWTMGTNGFNLFTVAAHEFGHALGLAHSTDPSALMYPTYKYKNPYGFHLPKDDVKGIQALYGPRKVFLGKPTLPHAPHHKPSIPDLCDSSSSFDAVTMLGKELLLFKDRIFWRRQVHLRTGIRPSTITSSFPQLMSNVDAAYEVAERGTAYFFKGPHYWITRGFQMQGPPRTIYDFGFPRHVQQIDAAVYLREPQKTLFFVGDEYYSYDERKRKMEKDYPKNTEEEFSGVNGQIDAAVELNGYIYFFSGPKTYKYDTEKEDVVSVVKSSSWIGC |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
MMP20 |
Purity |
Protein G purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
This antibody is useful for Western Blot, Functional |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.4) |
Preservative |
No Preservative |
Purity |
Protein G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for MMP20 Antibody
Background
MMP-20 (enamelysin) is a recently discovered member of the MMP family. This enzyme is involved in the degradation of the various components of the extracellular matrix (ECM) during development, haemostasis and pathological conditions. MMP-20 expression has been found to be restricted to the enamel organ and due to its unique expression pattern, may primarily be involved in the turnover of these molecules during tooth development. The enamel matrix proteins amelogenin, ameloblastin, and enamelin are expressed during the developmental time period, suggesting that MMP-20 may play a role in their hydrolysis (1). Recombinant human enamelysin is able to degrade amelogenin, the major protein component of the enamel matrix. On the basis of its degrading activity on amelogenin, and its highly restricted expression to dental tissues, we suggest that human enamelysin plays a central role in the process of tooth enamel formation (2). Enamelysin null mice do not process amelogenin properly, possesses an altered enamel matrix and rod pattern, has hypoplastic enamel that delaminates from the dentin, and has a deteriorating enamel organ morphology as development progresses (3).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Mu
Applications: WB
Species: Hu, Mu
Applications: WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu, Rt
Applications: IHC, IHC-P, WB
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA, S-ELISA, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Publications for MMP20 Antibody (H00009313-D01P) (0)
There are no publications for MMP20 Antibody (H00009313-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MMP20 Antibody (H00009313-D01P) (0)
There are no reviews for MMP20 Antibody (H00009313-D01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MMP20 Antibody (H00009313-D01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MMP20 Products
Research Areas for MMP20 Antibody (H00009313-D01P)
Find related products by research area.
|
Blogs on MMP20