MKLP1 Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FDGEGKVRMIVCVNPKAEDYEENLQVMRFAEVTQEVEVARPVDKAICGLTPGRRYRNQPRGPVGNEPLVTDVVLQSFPPLPSCEILDINDEQTLPRLIEALEKRHNLRQMMIDEFNKQSNAFKALLQEFDNAVLSKENHMQGKLN |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
KIF23 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
Application Notes |
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for MKLP1 Antibody
Background
Using the CHO1 monoclonal antibody, Sellitto and Kuriyama (1988) identified a spindle antigen that was shown by Nislow et al. (1990) to be required for mitotic progression. By using the CHO1 antibody to screen a HeLa cell cDNA library, Nislow et al. (1992) isolated a KNSL5 cDNA, which they called MKLP1 (mitotic kinesin-like protein-1), that encodes this antigen. The N-terminal region of the deduced 961-amino acid protein contains a 350-residue domain that shares 30 to 45% identity with the motor domains of other members of the kinesin superfamily. The C-terminal region shows little identity with other kinesins. A central region contains heptad repeats of hydrophobic residues that may assemble into a coiled-coil structure similar to kinesin and myosin heavy chain proteins. The protein also contains a putative nuclear localization signal and 2 consensus phosphorylation sites characteristic of nuclear proteins.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
Species: Ch, Hu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Dr, Hu, Ma, Mu, Pl, Po, Rt
Applications: IB, ICC/IF, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF
Publications for MKLP1 Antibody (NBP2-55279) (0)
There are no publications for MKLP1 Antibody (NBP2-55279).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MKLP1 Antibody (NBP2-55279) (0)
There are no reviews for MKLP1 Antibody (NBP2-55279).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MKLP1 Antibody (NBP2-55279) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MKLP1 Products
Research Areas for MKLP1 Antibody (NBP2-55279)
Find related products by research area.
|
Blogs on MKLP1