Home » Melusin/ITGB1BP2 » Melusin Peptides and Proteins » Recombinant Human Melusin/ITGB1BP2 GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human Melusin/ITGB1BP2 GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human Melusin/ITGB1BP2 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-347 of Human ITGB1BP2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MSLLCRNKGCGQHFDPNTNLPDSCCHHPGVPIFHDALKGWSCCRKRTVDFSEFLNIKGCTMGPHCAEKLPEAPQPEGPATSSSLQEQKPLNVIPKSAETLRRERPKSELPLKLLPLNISQALEMALEQKELDQEPGAGLDSLIRTGSSCQNPGCDAVYQGPESDATPCTYHPGAPRFHEGMKSWSCCGIQTLDFGAFLAQPGCRVGRHDWGKQLPASCRHDWHQTDSLVVVTVYGQIPLPAFNWVKASQTELHVHIVFDGNRVFQAQMKLWGVINVEQSSVFLMPSRVEISLVKADPGSWAQLEHPDALAKKARAGVVLEMDEEESDDSDDDLSWTEEEEEEEAMGE
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
ITGB1BP2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
64.8 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Melusin/ITGB1BP2 GST (N-Term) Protein

  • CHORDC3
  • integrin beta 1 binding protein (melusin) 2
  • integrin beta-1-binding protein 2
  • ITGB1BP
  • ITGB1BP2
  • Melusin
  • MGC119214

Background

ITGB1BP2 is a gene which codes for a protein that is expressed in skeletal and cardiac muscles that may play a role during the organization and maturation of muscle cells and is comprised of 347 amino acids, weighing approximately 38 kDa. Studies are being conducted on diseases and disorders relating to this gene including muscular dystrophy, cardiomyopathy, hypertension and hypertrophy. ITGB1BP2 has also been shown to have interactions with EDC, SUGT1, HSP90AA1, RARA, and RARG.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
FAK Antibody
[Unconjugated]
AF4467
Immunohistochemistry FAK Antibody [Unconjugated]
Knockout Validated FAK Antibody [Unconjugated]
Western Blot FAK Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
SUGT1 Antibody
(1A10)
H00010910-M04
Immunoprecipitation SUGT1 Antibody (1A10)
Western Blot SUGT1 Antibody (1A10)
Western Blot SUGT1 Antibody (1A10)
Species: Hu, Mu, Rt
Applications: ELISA, IP, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
eIF3K Antibody
NB100-93304
Western Blot eIF3K Antibody
Western Blot eIF3K Antibody
Western Blot eIF3K Antibody
(7 Publications)
Species: ChHa, Hu
Applications: IP, WB
CHORDC1 Antibody -
BSA Free
NBP1-78304
Immunocytochemistry/ Immunofluorescence CHORDC1 Antibody - BSA Free
Immunohistochemistry CHORDC1 Antibody - BSA Free
Western Blot CHORDC1 Antibody - BSA Free
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
SGTA Antibody
(2E11)
H00006449-M06
Immunocytochemistry/ Immunofluorescence SGTA Antibody (2E11)
Western Blot SGTA Antibody (2E11)
Western Blot SGTA Antibody (2E11)
Species: Hu
Applications: ELISA, ICC/IF, IP, S-ELISA, WB
GCR2 Antibody
(PCRP-ECD-1D10)
NBP3-13849
Flow Cytometry GCR2 Antibody (PCRP-ECD-1D10)
Immunocytochemistry/ Immunofluorescence GCR2 Antibody (PCRP-ECD-1D10)
Protein Array GCR2 Antibody (PCRP-ECD-1D10)
Species: Hu
Applications: Flow, ICC/IF, IP, PA
Integrin beta
1/CD29 Antibody (P5D2 ...
MAB17781
Flow Cytometry Integrin beta 1/CD29 Antibody (P5D2) [Unconjugated]
Immunocytochemistry Integrin beta 1/CD29 Antibody (P5D2) [Unconjugated]
Flow Cytometry Integrin beta 1/CD29 Antibody (P5D2) [Unconjugated]
(34 Publications)
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
IQGAP1 Antibody
(2C5)
H00008826-M01
Knockdown Validated IQGAP1 Antibody (2C5)
Western Blot IQGAP1 Antibody (2C5)
Western Blot IQGAP1 Antibody (2C5)
(5 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB
HSP90 alpha
Antibody
NB120-2928
Immunohistochemistry HSP90 alpha Antibody
Immunohistochemistry HSP90 alpha Antibody
Immunohistochemistry-Paraffin HSP90 alpha Antibody
(13 Publications)
Species: Hu, Mu, Pm, Rb, Rt, Sh
Applications: ICC/IF, IHC, IHC-P, IP, WB
MEK1 Antibody
(OTI1F5)
NBP1-47833
Western Blot MEK1 Antibody (OTI1F5)
Immunohistochemistry-Paraffin MEK1 Antibody (OTI1F5)
Immunohistochemistry-Paraffin MEK1 Antibody (OTI1F5)
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Integrin beta
2/CD18 Antibody [Unco ...
AF1730
Immunocytochemistry Integrin beta 2/CD18 Antibody [Unconjugated]
Immunocytochemistry Integrin beta 2/CD18 Antibody [Unconjugated]
(16 Publications)
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
Vinculin Antibody
(728526) [Unconjugate ...
MAB6896
Simple Western Vinculin Antibody (728526) [Unconjugated]
Western Blot Vinculin Antibody (728526) [Unconjugated]
Immunohistochemistry Vinculin Antibody (728526) [Unconjugated]
(3 Reviews)
(19 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
VASP Antibody
(OTI4D6)
NBP2-00555
Flow Cytometry VASP Antibody (OTI4D6)
Flow Cytometry VASP Antibody (OTI4D6)
Western Blot VASP Antibody (OTI4D6)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB

Calcium-binding-protei
NBP1-33736
Immunohistochemistry-Paraffin Calcium-binding-protein-P22 Antibody
Immunocytochemistry/ Immunofluorescence Calcium-binding-protein-P22 Antibody
Immunohistochemistry-Paraffin Calcium-binding-protein-P22 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Rhodopsin Antibody
(4D2)
NBP2-59690
Immunohistochemistry-Frozen Rhodopsin Antibody (4D2)
Western Blot Rhodopsin Antibody (4D2)
Immunohistochemistry Rhodopsin Antibody (4D2)
(1 Review)
(6 Publications)
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
MD-2
1787-MD
MD-2
(19 Publications)
Species: Hu
Applications: Bind
Recombinant Human
Melusin/ITGB1BP2 GST ...
H00026548-P01
Recombinant Human Melusin/ITGB1BP2 GST (N-Term) Protein
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for Melusin/ITGB1BP2 Recombinant Protein (H00026548-P01) (0)

There are no publications for Melusin/ITGB1BP2 Recombinant Protein (H00026548-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Melusin/ITGB1BP2 Recombinant Protein (H00026548-P01) (0)

There are no reviews for Melusin/ITGB1BP2 Recombinant Protein (H00026548-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Melusin/ITGB1BP2 Recombinant Protein (H00026548-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Melusin/ITGB1BP2 Products

Research Areas for Melusin/ITGB1BP2 Recombinant Protein (H00026548-P01)

Find related products by research area.

Blogs on Melusin/ITGB1BP2

There are no specific blogs for Melusin/ITGB1BP2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Melusin/ITGB1BP2 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol ITGB1BP2