Home » MEK2 » MEK2 Antibodies » MEK2 Antibody

MEK2 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: MEK2 Antibody [NBP2-38660] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
Western Blot: MEK2 Antibody [NBP2-38660] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
Immunocytochemistry/ Immunofluorescence: MEK2 Antibody [NBP2-38660] - Immunofluorescent staining of human cell line MCF7 shows localization to cytosol.
Immunohistochemistry: MEK2 Antibody [NBP2-38660] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

MEK2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MLARRKPVLPALTINPTIAEGPSPTSEGASEANLVDLQKKLEEL
Predicted Species
Mouse (100%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAP2K2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MEK2 Protein (NBP2-38660PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MEK2 Antibody

  • ERK activator kinase 2
  • MAP2K2
  • MAPKK 2
  • MEK 2
  • MEK2
  • MEK2EC 2.7.12.2
  • mitogen-activated protein kinase kinase 2
  • MKK2
  • MKK2FLJ26075
  • p45
  • PRKMK2MAPKK2

Background

MEK1 and MEK2 (MAPK kinase 1/2, or ERK kinase 1/2) are mitogen-activated protein kinases that stimulate MAP kinase activity, playing a role in both cell growth and differentiation (1,2). MEK itself is activated via phosphorylation at serines 217/218 and 221/222 by upstream activator kinases, including c-raf, mos and MEK kinase (3,4). MEK1 and MEK2 are activated by a wide variety of growth factors and cytokines, and also by membrane depolarization and calcium influx (5).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MEK1 Antibody
(OTI1F5)
NBP1-47833
Western Blot MEK1 Antibody (OTI1F5)
Immunohistochemistry-Paraffin MEK1 Antibody (OTI1F5)
Immunohistochemistry-Paraffin MEK1 Antibody (OTI1F5)
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
EphB2 Antibody
[Unconjugated]
AF467
Simple Western EphB2 Antibody [Unconjugated]
Western Blot EphB2 Antibody [Unconjugated]
Immunocytochemistry EphB2 Antibody [Unconjugated]
(5 Reviews)
(63 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
p38 gamma/SAPK3
Antibody [Unconjugate
AF1347
Immunocytochemistry p38 gamma/SAPK3 Antibody [Unconjugated]
Simple Western p38 gamma/SAPK3 Antibody [Unconjugated]
Western Blot p38 gamma/SAPK3 Antibody [Unconjugated]
(8 Publications)
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
Raf-1 Antibody
(563002) [Unconjugate
MAB4540
Western Blot Raf-1 Antibody (563002) [Unconjugated]
Immunohistochemistry Raf-1 Antibody (563002) [Unconjugated]
Simple Western Raf-1 Antibody (563002) [Unconjugated]
(2 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
SGSM3 Antibody
NBP2-13304
Immunohistochemistry-Paraffin SGSM3 Antibody
Immunocytochemistry/ Immunofluorescence SGSM3 Antibody
Western Blot SGSM3 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
ZHX2 Antibody
NBP1-82956
Immunocytochemistry/ Immunofluorescence ZHX2 Antibody
Immunohistochemistry-Paraffin ZHX2 Antibody
Immunohistochemistry-Paraffin ZHX2 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(50 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
EGF [Unconjugated]
236-EG
SDS-PAGE EGF [Unconjugated]
Bioactivity EGF [Unconjugated]
Cell Culture EGF [Unconjugated]
(859 Publications)
Species: Hu
Applications: BA
B-Raf Antibody
(OTI5A9)
NBP1-47668
Immunohistochemistry B-Raf Antibody (OTI5A9)
Western Blot B-Raf Antibody (OTI5A9)
Flow Cytometry B-Raf Antibody (OTI5A9)
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(820 Publications)
Species: Hu
Applications: BA
JNK1 Antibody
(228601) [Unconjugate
MAB17761
Western Blot JNK1 Antibody (228601) [Unconjugated]
Western Blot JNK1 Antibody (228601) [Unconjugated]
Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC, WB
p38 alpha Antibody
[Unconjugated]
AF8691
Simple Western p38 alpha Antibody [Unconjugated]
Western Blot p38 alpha Antibody [Unconjugated]
Immunohistochemistry p38 alpha Antibody [Unconjugated]
(1 Review)
(11 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
PSMC6 Antibody
(2C4)
H00005706-M02
Western Blot PSMC6 Antibody (2C4)
Immunocytochemistry/ Immunofluorescence PSMC6 Antibody (2C4)
Western Blot PSMC6 Antibody (2C4)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, WB
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
MEK2 Antibody
NBP2-38660
MEK2 Antibody
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC

Publications for MEK2 Antibody (NBP2-38660) (0)

There are no publications for MEK2 Antibody (NBP2-38660).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MEK2 Antibody (NBP2-38660) (0)

There are no reviews for MEK2 Antibody (NBP2-38660). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MEK2 Antibody (NBP2-38660) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MEK2 Products

Research Areas for MEK2 Antibody (NBP2-38660)

Find related products by research area.

Blogs on MEK2

There are no specific blogs for MEK2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MEK2 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol MAP2K2
Uniprot