![Western Blot: MDH2 Antibody [NBP1-54649] - This Anti-MDH2 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 2.5ug/ml.](http://images.novusbio.com/fullsize/MDH2-Antibody-Western-Blot-NBP1-54649-img0001.jpg "Western Blot: MDH2 Antibody [NBP1-54649] - This Anti-MDH2 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 2.5ug/ml.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 1 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptides corresponding to MDH2(malate dehydrogenase 2, NAD (mitochondrial)) The peptide sequence was selected from the C terminal of MDH2 (NP_005909).
Peptide sequence TYFSTPLLLGKKGIEKNLGIGKVSSFEEKMISDAIPELKASIKKGEDFVK. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MDH2 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 33 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 1 mg/ml |
| Purity | Protein A purified |
![Immunohistochemistry Neurophysin II/Arg-vasopressin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af009_human-neurophysin-ii-affinity-purified-polyclonal-ab-immunohistochemistry-2812202013195.jpg)
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: MDH2 Antibody [NBP1-54649] - C-terminal region staining of Proximal kidney tubules purfied from cortex at 1:1000.](http://images.novusbio.com/fullsize/MDH2-Antibody-Immunohistochemistry-NBP1-54649-img0002.jpg "Western Blot: MDH2 Antibody [NBP1-54649] - C-terminal region staining of Proximal kidney tubules purfied from cortex at 1:1000.")
![Knockout Validated Isocitrate Dehydrogenase 1/IDH1 Antibody (843219) [Unconjugated]](https://images.novusbio.com/images2/Isocitrate_Dehydrogenase_1_MAB7049_Knockout_Validated_22540.jpg)
![Immunocytochemistry Isocitrate Dehydrogenase 1/IDH1 Antibody (843219) [Unconjugated]](https://images.novusbio.com/images2/Isocitrate_Dehydrogenase_1_MAB7049_Immunocytochemistry__Immunofluorescence_19067.jpg)
![Western Blot Isocitrate Dehydrogenase 1/IDH1 Antibody (843219) [Unconjugated]](https://images.novusbio.com/images2/Isocitrate_Dehydrogenase_1_MAB7049_Western_Blot_13853.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")