![Immunohistochemistry-Paraffin: MAP1A Antibody [NBP1-82801] - Staining of human lymph node.](http://images.novusbio.com/fullsize/MAP1A-Antibody-Immunohistochemistry-Paraffin-NBP1-82801-img0007.jpg "Immunohistochemistry-Paraffin: MAP1A Antibody [NBP1-82801] - Staining of human lymph node.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SSFSHSTPSGNGKYLPGAITSPDEHILTPDSSFSKSPESLPGPALEDIAIKWEDKVPGLKDRTSEQKKEPEPKDEVLQQKD |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MAP1A |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot MAP1B [p Thr1265] Antibody - SuperBUGS](https://images.novusbio.com/images/MAP1B-[p-Thr1265]-Antibody-SuperBUGS-Western-Blot-NBP1-42827-img0005.jpg)
![Western Blot MAP1B [p Thr1265] Antibody - SuperBUGS](https://images.novusbio.com/images/MAP1B-[p-Thr1265]-Antibody---SuperBUGS-Western-Blot-NBP1-42827-img0003.jpg)
![Immunohistochemistry MAP1B [p Thr1265] Antibody - SuperBUGS](https://images.novusbio.com/images/MAP1B-[p-Thr1265]-Antibody---SuperBUGS-Immunohistochemistry-NBP1-42827-img0004.jpg)
Secondary Antibodies |
Isotype Controls |
|
Why LC3B Antibodies Make Ideal Autophagosomes Membrane Markers The human form of microtubule-associated protein light chain 3 (LC3) is expressed as 3 splice variants LC3A, LC3B, and LC3C.1 LC3B is a subunit of the MAP1A and MAP1B microtubule-binding proteins and plays a central role in autophagosome membrane stru... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MAP1A |
![Immunohistochemistry-Paraffin: MAP1A Antibody [NBP1-82801] - Staining of human cerebral cortex shows high expression.](http://images.novusbio.com/fullsize/MAP1A-Antibody-Immunohistochemistry-Paraffin-NBP1-82801-img0002.jpg "Immunohistochemistry-Paraffin: MAP1A Antibody [NBP1-82801] - Staining of human cerebral cortex shows high expression.")
![Immunohistochemistry-Paraffin: MAP1A Antibody [NBP1-82801] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/MAP1A-Antibody-Immunohistochemistry-Paraffin-NBP1-82801-img0003.jpg "Immunohistochemistry-Paraffin: MAP1A Antibody [NBP1-82801] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: MAP1A Antibody [NBP1-82801] - Staining in human cerebral cortex and pancreas tissues using anti-MAP1A antibody. Corresponding MAP1A RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/MAP1A-Antibody-Immunohistochemistry-Paraffin-NBP1-82801-img0004.jpg "Immunohistochemistry-Paraffin: MAP1A Antibody [NBP1-82801] - Staining in human cerebral cortex and pancreas tissues using anti-MAP1A antibody. Corresponding MAP1A RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: MAP1A Antibody [NBP1-82801] - Staining of human cerebellum, cerebral cortex, lymph node and pancreas using Anti-MAP1A antibody NBP1-82801 (A) shows similar protein distribution across tissues to independent antibody NBP2-32630 (B).](http://images.novusbio.com/fullsize/MAP1A-Antibody-Immunohistochemistry-Paraffin-NBP1-82801-img0005.jpg "Immunohistochemistry-Paraffin: MAP1A Antibody [NBP1-82801] - Staining of human cerebellum, cerebral cortex, lymph node and pancreas using Anti-MAP1A antibody NBP1-82801 (A) shows similar protein distribution across tissues to independent antibody NBP2-32630 (B).")
![Immunohistochemistry-Paraffin: MAP1A Antibody [NBP1-82801] - Staining of human cerebellum.](http://images.novusbio.com/fullsize/MAP1A-Antibody-Immunohistochemistry-Paraffin-NBP1-82801-img0006.jpg "Immunohistochemistry-Paraffin: MAP1A Antibody [NBP1-82801] - Staining of human cerebellum.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")