Home » MAGI3 » MAGI3 Proteins » MAGI3 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

MAGI3 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for MAGI3 Protein (NBP1-81266PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

MAGI3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MAGI3.

Source: E. coli

Amino Acid Sequence: LKVGDHISAVNGQSIVELSHDNIVQLIKDAGVTVTLTVIAEEEHHGPPSGTNSARQSPALQHRPMGQSQANHIPGDRSALEGEIGKDVSTSYRHSWSDHKHLAQPDTAVISVVGSRHNQNLGCYPVELERGPRGFGFSLRG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MAGI3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81266.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MAGI3 Recombinant Protein Antigen

  • dJ730K3.2
  • MAGI-3
  • membrane associated guanylate kinase, WW and PDZ domain containing 3
  • membrane-associated guanylate kinase inverted 3
  • membrane-associated guanylate kinase-related 3
  • WW and PDZ domain-containing protein 3

Background

MAGI3 - membrane associated guanylate kinase, WW and PDZ domain containing 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Guanylate kinase
Antibody (OTI4A8)
NBP2-00594
Flow Cytometry Guanylate kinase Antibody (OTI4A8)
Flow Cytometry Guanylate kinase Antibody (OTI4A8)
Flow Cytometry Guanylate kinase Antibody (OTI4A8)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
MAGI2 Antibody
AF7117
Western Blot MAGI2 Antibody
Immunohistochemistry MAGI2 Antibody
Immunocytochemistry MAGI2 Antibody
(1 Publication)
Species: Hu, Mu
Applications: ICC, IHC, WB
MAGI1 Antibody
(7B4)
H00009223-M03
ELISA MAGI1 Antibody (7B4)
Immunocytochemistry/ Immunofluorescence MAGI1 Antibody (7B4)
Western Blot MAGI1 Antibody (7B4)
(3 Publications)
Species: Ca, Ha, Hu, Rt
Applications: ELISA, ICC/IF, WB
Tight Junction
Protein 1 Antibody
NBP1-85047
Immunocytochemistry/ Immunofluorescence Tight Junction Protein 1 Antibody
Immunocytochemistry/ Immunofluorescence Tight Junction Protein 1 Antibody
Immunohistochemistry-Paraffin Tight Junction Protein 1 Antibody
(5 Reviews)
(20 Publications)
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
DLG1 Antibody
NB600-1229
Immunocytochemistry/ Immunofluorescence DLG1 Antibody
Immunocytochemistry/ Immunofluorescence DLG1 Antibody
Western Blot DLG1 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Vang-like Protein
2/VANGL2 Antibody
AF4815
Western Blot Vang-like Protein 2/VANGL2 Antibody
Immunohistochemistry Vang-like Protein 2/VANGL2 Antibody
(12 Publications)
Species: Hu, Mu, Rt
Applications: IHC, WB
MUPP1 Antibody
NBP1-54331
Western Blot MUPP1 Antibody
Western Blot MUPP1 Antibody
Immunohistochemistry-Paraffin MUPP1 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
PSD-95 Antibody
(6G6-1C9) - BSA Free
NB300-556
Flow Cytometry PSD-95 Antibody (6G6-1C9) - BSA Free
Immunocytochemistry/ Immunofluorescence PSD-95 Antibody (6G6-1C9) - BSA Free
Immunocytochemistry/ Immunofluorescence PSD-95 Antibody (6G6-1C9) - BSA Free
(1 Review)
(31 Publications)
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
PTEN Antibody
[Unconjugated]
AF847
Western Blot PTEN Antibody [Unconjugated]
Simple Western PTEN Antibody [Unconjugated]
Knockout Validated PTEN Antibody [Unconjugated]
(15 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NHERF-2 Antibody
NB100-2450
Western Blot NHERF-2 Antibody
Immunohistochemistry-Paraffin NHERF-2 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
EphB2 Antibody
[Unconjugated]
AF467
Simple Western EphB2 Antibody [Unconjugated]
Western Blot EphB2 Antibody [Unconjugated]
Immunocytochemistry EphB2 Antibody [Unconjugated]
(5 Reviews)
(62 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
beta-2 Adrenergic
R/ADRB2 Antibody (JM1 ...
NBP2-67187
Immunohistochemistry-Paraffin beta-2 Adrenergic R/ADRB2 Antibody (JM102-06)
Immunohistochemistry-Paraffin beta-2 Adrenergic R/ADRB2 Antibody (JM102-06)
Western Blot beta-2 Adrenergic R/ADRB2 Antibody (JM102-06)
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, IP, WB
Scribble Antibody
NBP2-15110
Western Blot Scribble Antibody
Immunohistochemistry-Paraffin Scribble Antibody
Western Blot Scribble Antibody
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Lipoprotein a
Antibody (4H1) - BSA
NBP2-37477
ELISA Lipoprotein a Antibody (4H1) - BSA Free
Western Blot Lipoprotein a Antibody (4H1) - BSA Free
Immunocytochemistry/ Immunofluorescence Lipoprotein a Antibody (4H1) - BSA Free
(2 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB

Publications for MAGI3 Protein (NBP1-81266PEP) (0)

There are no publications for MAGI3 Protein (NBP1-81266PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAGI3 Protein (NBP1-81266PEP) (0)

There are no reviews for MAGI3 Protein (NBP1-81266PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MAGI3 Protein (NBP1-81266PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MAGI3 Products

Research Areas for MAGI3 Protein (NBP1-81266PEP)

Find related products by research area.

Blogs on MAGI3

There are no specific blogs for MAGI3, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Simple Western lane view shows lysates of COLO 205 human colorectal adenocarcinoma cell line and MBA‑MB‑468 human breast cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for EphB2 at approximately 139 and 146 kDa (as indicated) using 20 µg/mL of Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
EphB2 Antibody [Unconjugated]
AF467

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MAGI3 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol MAGI3