![Western Blot: MAD2L2 Antibody [H00010459-B02P] - Analysis of MAD2L2 expression in transfected 293T cell line by MAD2L2 polyclonal antibody. Lane 1: MAD2L2 transfected lysate(23.21 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/MAD2L2-Antibody-Western-Blot-H00010459-B02P-img0002.jpg "Western Blot: MAD2L2 Antibody [H00010459-B02P] - Analysis of MAD2L2 expression in transfected 293T cell line by MAD2L2 polyclonal antibody. Lane 1: MAD2L2 transfected lysate(23.21 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | MAD2L2 (AAH15244.1, 1 a.a. - 211 a.a.) full-length human protein. MTTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPELNQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSISSDSLLSHVEQLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQLYVEERAHKGS |
| Specificity | MAD2L2 - MAD2 mitotic arrest deficient-like 2 (yeast), |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | MAD2L2 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against Recombinant Protein with GST tag in Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. This product is also useful for ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_15885.jpg)
![Immunohistochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunohistochemistry_15886.jpg)
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_16572.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for MAD2L2 Antibody (H00010459-B02P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MAD2L2 |
| Entrez |
|
| Uniprot |
|
![Immunocytochemistry Mxi1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Mxi1_AF4185_Immunocytochemistry__Immunofluorescence_20286.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")