Reactivity | Hu, Mu, RtSpecies Glossary |
Applications | WB, ICC/IF, IHC |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VVGQLIPDCYVELEKIILSERKNVPIEFPVIDRKRLLQLVRENQLQLDENELPHAVHFLNESGVLLHFQDPALQLSDLYFVEPKWLCKIMAQILTVKVEGCPKHPKGIISRRDVEKFLSKKRKFPKNYMSQYFKLL |
Predicted Species | Mouse (91%), Rat (91%). Backed by our 100% Guarantee. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | LRRK2 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for LRRK2 Antibody (NBP2-48524)Find related products by research area.
|
The role of Parkin and autophagy in retinal pigment epithelial cell (RPE) degradation The root of Parkinson’s disease (PD) points to a poorly regulated electron transport chain leading to mitochondrial damage, where many proteins need to work cohesively to ensure proper function. The two key players of this pathway are PINK1, ... Read full blog post. |
The identification of dopaminergic neurons using Tyrosine Hydroxylase in Parkinson's research and LRRK2 Tyrosine hydroxylase (TH) is a crucial enzyme involved in the biosynthesis of dopamine, norepinephrine and epinephrine in the brain. Specifically, TH catalyzes the conversion of l-tyrosine to l-dihydroxyphenylalanine (l-dopa). The importance of t... Read full blog post. |
Parkinson's Disease Infographic Parkinson's disease affects the nervous system which controls movement. Damage to the levels of dopamine in the brain impairs the ability to relay messages to parts of the body which control movement. While the exact cause of the disease is unknown, r... Read full blog post. |
Novus Antibodies Highlighted in Parkinson's Disease Research Identified almost two centuries ago, Parkinson's disease is a neurodegenerative disorder that afflicts an estimated 4-6 million worldwide (www.parkinsons.org). The prevalence of Parkinson's disease is expected to grow considerably as the average age o... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | LRRK2 |