Home » LOXL4 » LOXL4 Antibodies » LOXL4 Antibody
Novus Biologicals products are now on bio-techne.com

LOXL4 Antibody

 (2 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: LOXL4 Antibody [NBP2-32692] - Staining of human cell line U-2 OS shows positivity in vesicles. Antibody staining is shown in green.
Immunocytochemistry/ Immunofluorescence: LOXL4 Antibody [NBP2-32692] - Staining of human cell line U-2 OS shows positivity in vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: LOXL4 Antibody [NBP2-32692] - Staining of human kidney shows strong positivity in extracellular matrix of renal tubules.
Immunohistochemistry-Paraffin: LOXL4 Antibody [NBP2-32692] - Staining of human placenta shows strong positivity in extracellular matrix of the trophoblast.
Immunohistochemistry-Paraffin: LOXL4 Antibody [NBP2-32692] - Staining of human testis shows moderate to strong positivity in extracellular matrix of peritubular myoid cells.
Immunohistochemistry-Paraffin: LOXL4 Antibody [NBP2-32692] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

LOXL4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RRHRGYLSETVSNALGPQGRRLEEVRLKPILASAKQHSPVTEGAVEVKYEGHWRQVCDQGWTMN
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LOXL4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
IHC-P, Retrieval method: HIER pH6. ICC/IF, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
LOXL4 Protein (NBP2-32692PEP)
Publications
Read Publications using
NBP2-32692 in the following applications:

Reactivity Notes

Use in Mouse reported in scientific publication (PMID: 32424143).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LOXL4 Antibody

  • EC 1.4.3
  • EC 1.4.3.-
  • FLJ21889
  • LOX L4
  • LOXC
  • LOXClysyl oxidase related C
  • LOXL4
  • lysyl oxidase homolog 4
  • lysyl oxidase-like 4
  • Lysyl oxidase-like protein 4
  • Lysyl oxidase-related protein C

Background

LOXL4 encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

LOX Antibody
NB100-2527
Immunocytochemistry/ Immunofluorescence LOX Antibody
Immunohistochemistry LOX Antibody
Western Blot LOX Antibody
(5 Reviews)
(38 Publications)
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Lysyl Oxidase
Homolog 3/LOXL3 Antib ...
NBP2-75964
Immunohistochemistry-Paraffin Lysyl Oxidase Homolog 3/LOXL3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Lysyl Oxidase Homolog 3/LOXL3 Antibody - BSA Free
Western Blot Lysyl Oxidase Homolog 3/LOXL3 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
LOXL1 Antibody
H00004016-D01P
Western Blot LOXL1 Antibody
Simple Western LOXL1 Antibody
Immunocytochemistry/ Immunofluorescence LOXL1 Antibody
(6 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, Simple Western, WB
Lysyl Oxidase
Homolog 2/LOXL2 Antib
NBP1-32954
Western Blot Lysyl Oxidase Homolog 2/LOXL2 Antibody
Immunohistochemistry-Paraffin Lysyl Oxidase Homolog 2/LOXL2 Antibody
Immunohistochemistry-Paraffin Lysyl Oxidase Homolog 2/LOXL2 Antibody
(1 Review)
(12 Publications)
Species: Fe, Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, KO, WB
Elastin Antibody
(BA-4)
NB100-2076
Immunohistochemistry-Paraffin Elastin Antibody (BA-4)
Immunohistochemistry-Paraffin Elastin Antibody (BA-4)
Immunohistochemistry-Paraffin Elastin Antibody (BA-4)
(2 Reviews)
(11 Publications)
Species: Bv, Fe, Hu, Rb
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Decorin Antibody
[Unconjugated]
AF143
Western Blot Decorin Antibody [Unconjugated]
Simple Western Decorin Antibody [Unconjugated]
Immunohistochemistry Decorin Antibody [Unconjugated]
(29 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
SR-BI Antibody -
BSA Free
NB400-104
Immunohistochemistry-Paraffin SR-BI Antibody - BSA Free
Knockdown Validated SR-BI Antibody - BSA Free
Western Blot SR-BI Antibody - BSA Free
(5 Reviews)
(233 Publications)
Species: ChHa, SyHa, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PLA, Simple Western, WB
Complement C3
Antibody (11H9) - BSA ...
NB200-540
Flow Cytometry Complement C3 Antibody (11H9) - BSA Free
Immunocytochemistry/ Immunofluorescence Complement C3 Antibody (11H9) - BSA Free
Immunohistochemistry-Paraffin Complement C3 Antibody (11H9) - BSA Free
(2 Reviews)
(31 Publications)
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
IL-4 [Unconjugated]
6507-IL/CF
Bioactivity IL-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(663 Publications)
Species: Mu
Applications: ELISA
IFN-gamma
[Unconjugated]
285-IF
Bioactivity IFN-gamma [Unconjugated]
SDS-PAGE IFN-gamma [Unconjugated]
SEC-MALS IFN-gamma [Unconjugated]
(2 Reviews)
(453 Publications)
Species: Hu
Applications: BA
Glutaminyl-peptide
Cyclotransferase/QPCT ...
NBP1-81838
Western Blot Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry-Paraffin Glutaminyl-peptide Cyclotransferase/QPCT Antibody
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
GM-CSF
[Unconjugated]
7954-GM/CF
Bioactivity GM-CSF [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
CLEC3B/Tetranectin
Antibody (805035) [Un ...
MAB5170
Simple Western CLEC3B/Tetranectin Antibody (805035) [Unconjugated]
Western Blot CLEC3B/Tetranectin Antibody (805035) [Unconjugated]
Species: Hu
Applications: Block, Simple Western, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(815 Publications)
Species: Hu
Applications: BA
HYPB Antibody -
Azide and BSA Free
NBP3-03807
Immunocytochemistry/ Immunofluorescence HYPB Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HYPB Antibody - Azide and BSA Free
Western Blot HYPB Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IP, WB

Publications for LOXL4 Antibody (NBP2-32692)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 2 applications: IF/IHC, Immunohistochemistry.


Filter By Application
IF/IHC
(1)
Immunohistochemistry
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for LOXL4 Antibody (NBP2-32692) (0)

There are no reviews for LOXL4 Antibody (NBP2-32692). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for LOXL4 Antibody (NBP2-32692) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LOXL4 Products

Research Areas for LOXL4 Antibody (NBP2-32692)

Find related products by research area.

Blogs on LOXL4

There are no specific blogs for LOXL4, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LOXL4 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol LOXL4