Home » Leukotriene B4 R1 » Leukotriene B4 R1 Proteins » Leukotriene B4 R1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Leukotriene B4 R1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Leukotriene B4 R1 Recombinant Protein Antigen (NBP1-89959PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Leukotriene B4 R1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LTB4R.

Source: E. coli

Amino Acid Sequence: GVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LTB4R
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89959.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Leukotriene B4 R1 Recombinant Protein Antigen

  • BLT1
  • chemokine receptor-like 1
  • CMKRL1
  • Leukotriene B4 R1
  • leukotriene B4 receptor
  • Leukotriene B4R1
  • LTB4R
  • LTB4R1
  • LTBR1
  • P2Y purinoceptor 7
  • purinergic receptor P2Y, G-protein coupled, 7

Background

BLTR2, also known as Leukotriene B4 Receptor 1, is a Chemoattractant Receptor that causes LTB4-induced chemotaxis, calcium mobilization, and inhibition of adenylyl cyclase. Portions of the coding regions of BLTR2 have been duplicated and are part of the 5' UTR noncoding regions of the clusters LS190955 (BLT1) and LS54843 (CIDE-B) on chromosome 14. BLTR2 has been reported in humans in peripheral blood leukocytes, mononuclear lymphocytes, and spleen. ESTs have been isolated from a broad array of human libraries, including brain, eye, fetal lung/testis/B-cell, heart, kidney, melanocyte/uterus/fetal heart, testis, tonsil, and uterus libraries

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Lymphotoxin
beta/TNFSF3 Antibody ...
MAB1684
Lymphotoxin beta/TNFSF3 Antibody (135105)
(2 Publications)
Species: Hu
Applications: WB
CD19 Antibody
(CB19) - BSA Free
NBP2-25196
Flow Cytometry CD19 Antibody (CB19) - BSA Free
Flow Cytometry CD19 Antibody (CB19) - BSA Free
Flow Cytometry CD19 Antibody (CB19) - BSA Free
(1 Review)
(12 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
5-Lipoxygenase
Antibody - BSA Free
NB110-58748
Knockdown Validated 5-Lipoxygenase Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence 5-Lipoxygenase Antibody - BSA Free
Simple Western 5-Lipoxygenase Antibody - BSA Free
(2 Reviews)
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, KD, Simple Western, WB
5-Lipoxygenase
Antibody - BSA Free
NB110-58748
Knockdown Validated 5-Lipoxygenase Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence 5-Lipoxygenase Antibody - BSA Free
Simple Western 5-Lipoxygenase Antibody - BSA Free
(2 Reviews)
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, KD, Simple Western, WB

Lymphotoxin-alpha/TNF- ...
211-TBB/CF
SDS-PAGE Lymphotoxin-alpha/TNF-beta [Unconjugated]
Bioactivity Lymphotoxin-alpha/TNF-beta [Unconjugated]
(8 Publications)
Species: Hu
Applications: BA
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(818 Publications)
Species: Hu
Applications: BA
CCL2/JE/MCP-1 [HRP]
DCP00
N/A CCL2/JE/MCP-1 [HRP]
N/A CCL2/JE/MCP-1 [HRP]
N/A CCL2/JE/MCP-1 [HRP]
(256 Publications)
Species: Hu
Applications: ELISA
Ovalbumin Antibody
NB600-922
Western Blot Ovalbumin Antibody
Western Blot Ovalbumin Antibody
Western Blot Ovalbumin Antibody
(10 Publications)
Species: Ch
Applications: ELISA, IHC, Single-Cell Western, WB

Myeloperoxidase/MPO An ...
AF3667
Western Blot Myeloperoxidase/MPO Antibody [Unconjugated]
Simple Western Myeloperoxidase/MPO Antibody [Unconjugated]
Immunocytochemistry Myeloperoxidase/MPO Antibody [Unconjugated]
(3 Reviews)
(167 Publications)
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
GPR151 Antibody -
BSA Free
NLS418
Immunohistochemistry-Paraffin GPR151 Antibody - BSA Free
Immunohistochemistry-Paraffin GPR151 Antibody - BSA Free
Immunohistochemistry-Paraffin GPR151 Antibody - BSA Free
Species: Hu
Applications: IHC, IHC-P
Lgr6 Antibody
(918719) [Unconjugate
MAB8458
Flow Cytometry Lgr6 Antibody (918719) [Unconjugated]
Immunocytochemistry Lgr6 Antibody (918719) [Unconjugated]
(1 Publication)
Species: Hu
Applications: CyTOF-ready, Flow, ICC
LPAR3/LPA3/EDG-7
Antibody - BSA Free
NLS1017
Immunohistochemistry-Paraffin LPAR3/LPA3/EDG-7 Antibody - BSA Free
Immunohistochemistry-Paraffin LPAR3/LPA3/EDG-7 Antibody - BSA Free
Immunohistochemistry-Paraffin LPAR3/LPA3/EDG-7 Antibody - BSA Free
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC, IHC-P
Frizzled-4
Antibody (145901)
MAB194
Frizzled-4 Antibody (145901)
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
MRGX1 Antibody -
BSA Free
NLS2756
Immunohistochemistry-Paraffin MRGX1 Antibody - BSA Free
Immunohistochemistry-Paraffin MRGX1 Antibody - BSA Free
Immunohistochemistry-Paraffin MRGX1 Antibody - BSA Free
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
GPRC6A Antibody -
BSA Free
NLS2576
Immunohistochemistry-Paraffin GPRC6A Antibody - BSA Free
Immunohistochemistry-Paraffin GPRC6A Antibody - BSA Free
Immunohistochemistry-Paraffin GPRC6A Antibody - BSA Free
(3 Publications)
Species: Hu, Pm, Rt
Applications: IHC, IHC-P
Leukotriene B4 R1
Recombinant Protein A ...
NBP1-89959PEP
Leukotriene B4 R1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Leukotriene B4 R1 Recombinant Protein Antigen (NBP1-89959PEP) (0)

There are no publications for Leukotriene B4 R1 Recombinant Protein Antigen (NBP1-89959PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Leukotriene B4 R1 Recombinant Protein Antigen (NBP1-89959PEP) (0)

There are no reviews for Leukotriene B4 R1 Recombinant Protein Antigen (NBP1-89959PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Leukotriene B4 R1 Recombinant Protein Antigen (NBP1-89959PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Leukotriene B4 R1 Products

Research Areas for Leukotriene B4 R1 Recombinant Protein Antigen (NBP1-89959PEP)

Find related products by research area.

Blogs on Leukotriene B4 R1

There are no specific blogs for Leukotriene B4 R1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Western blot shows lysates of HL-60 human acute promyelocytic leukemia cell line, human neutrophil cells, and mouse spleen tissue. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse Myeloperoxidase/MPO Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3667) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (HAF019). A specific band was detected for Myeloperoxidase/MPO at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 2.
Myeloperoxidase/MPO Antibody [Unconjugated]
AF3667

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Leukotriene B4 R1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol LTB4R