![Western Blot: LASS4 Antibody (7D5) [H00079603-M03] - Analysis of LASS4 expression in HeLa (Cat # L013V1).](http://images.novusbio.com/fullsize/LASS4-Antibody-7D5-Western-Blot-H00079603-M03-img0005.jpg "Western Blot: LASS4 Antibody (7D5) [H00079603-M03] - Analysis of LASS4 expression in HeLa (Cat # L013V1).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF |
| Clone | 7D5 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | LASS4 (NP_078828, 57 a.a. ~ 139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ERFIGLPLSRWLGVRDQTRRQVKPNATLEKHFLTEGHRPKEPQLSLLAAQCGLTLQQTQRWFRRRRNQDRPQLTKKFCEASWR |
| Specificity | LASS4 - LAG1 longevity assurance homolog 4 (S. cerevisiae) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | CERS4 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: LASS4 Antibody (7D5) [H00079603-M03] - Analysis of monoclonal antibody to LASS4 on HeLa cell. Antibody concentration 10 ug/ml](http://images.novusbio.com/fullsize/LASS4-Antibody-7D5-Immunocytochemistry-Immunofluorescence-H00079603-M03-img0004.jpg "Immunocytochemistry/Immunofluorescence: LASS4 Antibody (7D5) [H00079603-M03] - Analysis of monoclonal antibody to LASS4 on HeLa cell. Antibody concentration 10 ug/ml")
![Western Blot: LASS4 Antibody (7D5) [H00079603-M03] - Analysis of LASS4 expression in transfected 293T cell line by LASS4 monoclonal antibody (M03), clone 7D5. Lane 1: LASS4 transfected lysatE (46.4 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/LASS4-Antibody-7D5-Western-Blot-H00079603-M03-img0006.jpg "Western Blot: LASS4 Antibody (7D5) [H00079603-M03] - Analysis of LASS4 expression in transfected 293T cell line by LASS4 monoclonal antibody (M03), clone 7D5. Lane 1: LASS4 transfected lysatE (46.4 KDa). Lane 2: Non-transfected lysate.")
![ELISA: LASS4 Antibody (7D5) [H00079603-M03] - Detection limit for recombinant GST tagged LASS4 is approximately 0.3ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/LASS4-Antibody-7D5-ELISA-H00079603-M03-img0003.jpg "ELISA: LASS4 Antibody (7D5) [H00079603-M03] - Detection limit for recombinant GST tagged LASS4 is approximately 0.3ng/ml as a capture antibody.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Bioactivity BMP-2 [Unconjugated]](https://images.novusbio.com/images/protein/355-bm_recombinant-human-mouse-rat-bmp-2-protein-bioactivity-181120209742.jpg)
