![Immunohistochemistry-Paraffin: Laminin beta 3 Antibody (CL3353) [NBP2-46622] - Analysis in human skin and pancreas tissues using NBP2-46622 antibody. Corresponding LAMB3 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Laminin-beta-3-Antibody-CL3353-Immunohistochemistry-Paraffin-NBP2-46622-img0021.jpg "Immunohistochemistry-Paraffin: Laminin beta 3 Antibody (CL3353) [NBP2-46622] - Analysis in human skin and pancreas tissues using NBP2-46622 antibody. Corresponding LAMB3 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clone | CL3353 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence KLVTSMTKQLGDFWTRMEELRHQARQQGAEAVQAQQLAEGASEQALSAQEGFERIKQKYAELKDRLGQSS mlGEQGARIQSVKTEAEELFGETMEMMDRMKDMELELLRGSQAI mlRSADLTGLEKRVEQ |
| Epitope | ASEQALSAQEGFERI |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | LAMB3 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
reviewed by:
Apu Saikia |
ICC | Rabbit | 05/04/2018 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: Laminin beta 3 Antibody (CL3353) [NBP2-46622] - Analysis of purified human recombinant Laminin-332, Laminin-421, Laminin-511, Laminin-121 and Laminin-221.](http://images.novusbio.com/fullsize/Laminin-beta-3-Antibody-CL3353-Western-Blot-NBP2-46622-img0018.jpg "Western Blot: Laminin beta 3 Antibody (CL3353) [NBP2-46622] - Analysis of purified human recombinant Laminin-332, Laminin-421, Laminin-511, Laminin-121 and Laminin-221.")
![Immunocytochemistry/Immunofluorescence: Laminin beta 3 Antibody (CL3353) [NBP2-46622] - Staining of A-431 cells using the Anti-LAMB3 monoclonal antibody, showing specific staining in the endoplasmic reticulum in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available). Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Laminin-beta-3-Antibody-CL3353-Immunocytochemistry-Immunofluorescence-NBP2-46622-img0019.jpg "Immunocytochemistry/Immunofluorescence: Laminin beta 3 Antibody (CL3353) [NBP2-46622] - Staining of A-431 cells using the Anti-LAMB3 monoclonal antibody, showing specific staining in the endoplasmic reticulum in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available). Antibody staining is shown in green.")
![Western Blot: Laminin beta 3 Antibody (CL3353) [NBP2-46622] - Analysis in human lung tissue](http://images.novusbio.com/fullsize/Laminin-beta-3-Antibody-CL3353-Western-Blot-NBP2-46622-img0017.jpg "Western Blot: Laminin beta 3 Antibody (CL3353) [NBP2-46622] - Analysis in human lung tissue")
![Immunohistochemistry-Paraffin: Laminin beta 3 Antibody (CL3353) [NBP2-46622] - Staining of human prostate shows immunoreactivity in basement membrane of glandular epithelium.](http://images.novusbio.com/fullsize/Laminin-beta-3-Antibody-CL3353-Immunohistochemistry-Paraffin-NBP2-46622-img0010.jpg "Immunohistochemistry-Paraffin: Laminin beta 3 Antibody (CL3353) [NBP2-46622] - Staining of human prostate shows immunoreactivity in basement membrane of glandular epithelium.")
![Immunohistochemistry-Paraffin: Laminin beta 3 Antibody (CL3353) [NBP2-46622] - Staining of human urinary bladder wall shows positivity in basement membrane of squamous epithelium.](http://images.novusbio.com/fullsize/Laminin-beta-3-Antibody-CL3353-Immunohistochemistry-Paraffin-NBP2-46622-img0011.jpg "Immunohistochemistry-Paraffin: Laminin beta 3 Antibody (CL3353) [NBP2-46622] - Staining of human urinary bladder wall shows positivity in basement membrane of squamous epithelium.")
![Immunohistochemistry-Paraffin: Laminin beta 3 Antibody (CL3353) [NBP2-46622] - Staining of human fallopian tube shows immunoreactivity in basement membrane of glandular epithelium.](http://images.novusbio.com/fullsize/Laminin-beta-3-Antibody-CL3353-Immunohistochemistry-Paraffin-NBP2-46622-img0012.jpg "Immunohistochemistry-Paraffin: Laminin beta 3 Antibody (CL3353) [NBP2-46622] - Staining of human fallopian tube shows immunoreactivity in basement membrane of glandular epithelium.")
![Immunohistochemistry-Paraffin: Laminin beta 3 Antibody (CL3353) [NBP2-46622] - Staining of human tonsil shows absence of immunoreactivity in lymphoid tissue (negative control).](http://images.novusbio.com/fullsize/Laminin-beta-3-Antibody-CL3353-Immunohistochemistry-Paraffin-NBP2-46622-img0013.jpg "Immunohistochemistry-Paraffin: Laminin beta 3 Antibody (CL3353) [NBP2-46622] - Staining of human tonsil shows absence of immunoreactivity in lymphoid tissue (negative control).")
![Immunohistochemistry-Paraffin: Laminin beta 3 Antibody (CL3353) [NBP2-46622] - Staining or rat rectum shows immunoreactivity in basement membrane of glandular epithelium and in blood vessels.](http://images.novusbio.com/fullsize/Laminin-beta-3-Antibody-CL3353-Immunohistochemistry-Paraffin-NBP2-46622-img0014.jpg "Immunohistochemistry-Paraffin: Laminin beta 3 Antibody (CL3353) [NBP2-46622] - Staining or rat rectum shows immunoreactivity in basement membrane of glandular epithelium and in blood vessels.")
![Immunohistochemistry-Paraffin: Laminin beta 3 Antibody (CL3353) [NBP2-46622] - Staining or rat lung shows positivity in basement membrane of respiratory epithelium.](http://images.novusbio.com/fullsize/Laminin-beta-3-Antibody-CL3353-Immunohistochemistry-Paraffin-NBP2-46622-img0015.jpg "Immunohistochemistry-Paraffin: Laminin beta 3 Antibody (CL3353) [NBP2-46622] - Staining or rat lung shows positivity in basement membrane of respiratory epithelium.")
![Immunohistochemistry-Paraffin: Laminin beta 3 Antibody (CL3353) [NBP2-46622] - Staining or rat kidney shows immunoreactivity in renal glomerulus.](http://images.novusbio.com/fullsize/Laminin-beta-3-Antibody-CL3353-Immunohistochemistry-Paraffin-NBP2-46622-img0016.jpg "Immunohistochemistry-Paraffin: Laminin beta 3 Antibody (CL3353) [NBP2-46622] - Staining or rat kidney shows immunoreactivity in renal glomerulus.")
![Intracellular Staining by Flow Cytometry Laminin alpha 3/Laminin-5 Antibody (546215) [Unconjugated]](https://images.novusbio.com/images2/Laminin_alpha_3_MAB21441_Flow_Cytometry_23202.jpg)
![Immunohistochemistry Laminin alpha 3/Laminin-5 Antibody (546215) [Unconjugated]](https://images.novusbio.com/images2/Laminin_alpha_3_MAB21441_Immunohistochemistry_23899.jpg)
![Immunocytochemistry Laminin alpha 3/Laminin-5 Antibody (546215) [Unconjugated]](https://images.novusbio.com/images2/Laminin_alpha_3_MAB21441_Immunocytochemistry_14581.jpg)
![Immunohistochemistry Laminin alpha 4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Laminin_alpha_4_AF3837_Immunohistochemistry_17439.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Immunohistochemistry Ret Antibody [Unconjugated]](https://images.novusbio.com/images2/Ret_AF482_Immunohistochemistry_10194.jpg)
![Western Blot Ret Antibody [Unconjugated]](https://images.novusbio.com/images/af482_mouse-ret-affinity-purified-polyclonal-ab-8220249503265.jpg)
![Immunohistochemistry Ret Antibody [Unconjugated]](https://images.novusbio.com/images/af482_mouse-ret-affinity-purified-polyclonal-ab-8220249505961.jpg)
![Bioactivity Thrombospondin-2 [Unconjugated]](https://images.novusbio.com/images2/Thrombospondin2_1635T2_3151.jpg)
![N/A Thrombospondin-1 [HRP]](https://images.novusbio.com/images2/Thrombospondin-1_DTSP10_ELISA_199.jpg)
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.](https://images.novusbio.com/images/Mouse-IgG1-Isotype-Control-MG1-SDS-Page-NBP1-97005-img0002.jpg "SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.")