![Immunocytochemistry/Immunofluorescence: Keap1 Antibody [NBP1-83106] - Staining of human cell line U-251 MG shows localization to nucleoplasm, cytosol & microtubule organizing center. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Keap1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83106-img0009.jpg "Immunocytochemistry/Immunofluorescence: Keap1 Antibody [NBP1-83106] - Staining of human cell line U-251 MG shows localization to nucleoplasm, cytosol & microtubule organizing center. Antibody staining is shown in green.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MYASTECKAEVTPSQHGNRTFSYTLEDHTKQAFGIMNELRLSQQLCDVTLQVKYQDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGMEVVSIEGIHPKVM |
| Predicted Species | Rat (97%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | KEAP1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Keap1 Antibody (NBP1-83106)Find related products by research area.
|
|
Read full blog post. |
|
Crosstalk Between Oxidative Stress and Autophagy By Christina Towers, PhD. Role of Reactive Species in Cellular FunctionOxidative stress is a byproduct of an imbalance between oxidants and antioxidants present in the cell, resulting in dysfunctional redox si... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | KEAP1 |
![Immunohistochemistry-Paraffin: Keap1 Antibody [NBP1-83106] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/Keap1-Antibody-Immunohistochemistry-Paraffin-NBP1-83106-img0013.jpg "Immunohistochemistry-Paraffin: Keap1 Antibody [NBP1-83106] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: Keap1 Antibody [NBP1-83106] - Staining of human skeletal muscle shows weak to moderate cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/Keap1-Antibody-Immunohistochemistry-Paraffin-NBP1-83106-img0010.jpg "Immunohistochemistry-Paraffin: Keap1 Antibody [NBP1-83106] - Staining of human skeletal muscle shows weak to moderate cytoplasmic positivity in myocytes.")
![Immunohistochemistry-Paraffin: Keap1 Antibody [NBP1-83106] - Staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/Keap1-Antibody-Immunohistochemistry-Paraffin-NBP1-83106-img0011.jpg "Immunohistochemistry-Paraffin: Keap1 Antibody [NBP1-83106] - Staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Keap1 Antibody [NBP1-83106] - Staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/Keap1-Antibody-Immunohistochemistry-Paraffin-NBP1-83106-img0012.jpg "Immunohistochemistry-Paraffin: Keap1 Antibody [NBP1-83106] - Staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.")
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")