![Western Blot: integrin beta 4 binding protein Antibody [NBP2-13954] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/integrin-beta-4-binding-protein-Antibody-Western-Blot-NBP2-13954-img0005.jpg "Western Blot: integrin beta 4 binding protein Antibody [NBP2-13954] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: LSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | EIF6 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation/Permeabilization: PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Neutralization Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prolactin_AF1445_Block_Neutralize_8779.jpg)
![Western Blot Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prolactin_AF1445_Western_Blot_20179.jpg)
![Immunohistochemistry Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af1445_mouse-rat-prolactin-affinity-purified-polyclonal-ab-immunohistochemistry-19202393922..jpg)
| Publication using NBP2-13954 | Applications | Species |
|---|---|---|
| Li J, Luco AL, Ochietti B et al. Tumoral Vitamin D Synthesis by CYP27B1 1-alpha-Hydroxylase Delays Mammary Tumor Progression in the PyMT-MMTV Mouse Model and Its Action Involves NF-kB Modulation. Endocrinology. 2016-04-27 [PMID: 27119753] (WB, ICC/IF, Mouse) | WB, ICC/IF | Mouse |
Secondary Antibodies |
Isotype Controls |
Research Areas for integrin beta 4 binding protein Antibody (NBP2-13954)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | EIF6 |
![Immunocytochemistry/Immunofluorescence: integrin beta 4 binding protein Antibody [NBP2-13954] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.](http://images.novusbio.com/fullsize/integrin-beta-4-binding-protein-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13954-img0006.jpg "Immunocytochemistry/Immunofluorescence: integrin beta 4 binding protein Antibody [NBP2-13954] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.")
![Immunohistochemistry-Paraffin: integrin beta 4 binding protein Antibody [NBP2-13954] - Staining of human Skeletal muscle shows very weak cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/integrin-beta-4-binding-protein-Antibody-Immunohistochemistry-Paraffin-NBP2-13954-img0012.jpg "Immunohistochemistry-Paraffin: integrin beta 4 binding protein Antibody [NBP2-13954] - Staining of human Skeletal muscle shows very weak cytoplasmic positivity in myocytes.")
![Western Blot: integrin beta 4 binding protein Antibody [NBP2-13954] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize/integrin-beta-4-binding-protein-Antibody-Western-Blot-NBP2-13954-img0004.jpg "Western Blot: integrin beta 4 binding protein Antibody [NBP2-13954] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp")
![Immunohistochemistry-Paraffin: integrin beta 4 binding protein Antibody [NBP2-13954] - Staining of human Colon shows strong nuclear and cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/integrin-beta-4-binding-protein-Antibody-Immunohistochemistry-Paraffin-NBP2-13954-img0010.jpg "Immunohistochemistry-Paraffin: integrin beta 4 binding protein Antibody [NBP2-13954] - Staining of human Colon shows strong nuclear and cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: integrin beta 4 binding protein Antibody [NBP2-13954] - Staining of human Liver shows strong cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/integrin-beta-4-binding-protein-Antibody-Immunohistochemistry-Paraffin-NBP2-13954-img0011.jpg "Immunohistochemistry-Paraffin: integrin beta 4 binding protein Antibody [NBP2-13954] - Staining of human Liver shows strong cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: integrin beta 4 binding protein Antibody [NBP2-13954] - Staining of human Skin shows strong nuclear and cytoplasmic positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/integrin-beta-4-binding-protein-Antibody-Immunohistochemistry-Paraffin-NBP2-13954-img0013.jpg "Immunohistochemistry-Paraffin: integrin beta 4 binding protein Antibody [NBP2-13954] - Staining of human Skin shows strong nuclear and cytoplasmic positivity in squamous epithelial cells.")
![Immunohistochemistry-Paraffin: integrin beta 4 binding protein Antibody [NBP2-13954] - Analysis in human skin and skeletal muscle tissues using NBP2-13954 antibody. Corresponding EIF6 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/integrin-beta-4-binding-protein-Antibody-Immunohistochemistry-Paraffin-NBP2-13954-img0009.jpg "Immunohistochemistry-Paraffin: integrin beta 4 binding protein Antibody [NBP2-13954] - Analysis in human skin and skeletal muscle tissues using NBP2-13954 antibody. Corresponding EIF6 RNA-seq data are presented for the same tissues.")
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_729.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_730.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/Kallikrein_3_DKK300_ELISA_124.jpg)
![Western Blot Protein S/PROS1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Protein_S_AF4036_Western_Blot_17082.jpg)
![Simple Western Protein S/PROS1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Protein_S_AF4036_Simple_Western_18689.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")