Home » INPP5E » INPP5E Proteins » INPP5E Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

INPP5E Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for INPP5E Recombinant Protein Antigen (NBP2-49463PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

INPP5E Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human INPP5E.

Source: E. coli

Amino Acid Sequence: GKDTYDSTSKQRTPSYTDRVLYRSRHKGDICPVSYSSCPGIKTSDHRPVYGLFRVKVRPGRDNIPLAAGKFDRELYLLGIKRRISKEIQRQQALQSQNSSTICSVS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
INPP5E
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49463.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for INPP5E Recombinant Protein Antigen

  • CORS172 kDa inositol polyphosphate 5-phosphatase
  • CPD4
  • EC 3.1.3.36
  • inositol polyphosphate-5-phosphatase, 72 kDa
  • JBTS1
  • Joubert syndrome 1
  • MGC117201
  • MORMS
  • phosphatidylinositol (4,5) bisphosphate 5-phosphatase
  • Phosphatidylinositol polyphosphate 5-phosphatase type IV
  • Phosphatidylinositol-4,5-bisphosphate 5-phosphatase
  • PPI5PIV

Background

INPP5E is encoded by this gene is an inositol 1,4,5-trisphosphate (InsP3) 5-phosphatase. InsP3 5-phosphatases hydrolyze Ins(1,4,5)P3, which mobilizes intracellular calcium and acts as a second messenger mediating cell responses to various stimulation. Studies of the mouse counterpart suggest that this protein may hydrolyze phosphatidylinositol 3,4, 5-trisphosphate and phosphatidylinositol 3,5-bisphosphate on the cytoplasmic Golgi membrane and thereby regulate Golgi-vesicular trafficking. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

OCRL Antibody
NBP1-80973
Western Blot OCRL Antibody
Immunohistochemistry-Paraffin OCRL Antibody
Immunohistochemistry-Paraffin OCRL Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, KD, WB
INPP5B Antibody
NBP1-89439
Immunocytochemistry/ Immunofluorescence INPP5B Antibody
Immunohistochemistry-Paraffin INPP5B Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Exosome component
10 Antibody
NBP1-82448
Western Blot Exosome component 10 Antibody
Immunohistochemistry-Paraffin Exosome component 10 Antibody
Immunohistochemistry-Paraffin Exosome component 10 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, KD, WB
SHIP Antibody
(257812) [Unconjugate
MAB2317
Western Blot SHIP Antibody (257812) [Unconjugated]
Immunocytochemistry SHIP Antibody (257812) [Unconjugated]
Knockout Validated SHIP Antibody (257812) [Unconjugated]
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
RPLP2 Antibody
NBP2-15104
Immunocytochemistry/ Immunofluorescence RPLP2 Antibody
Immunohistochemistry-Paraffin RPLP2 Antibody
Western Blot RPLP2 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

FABP8/M-FABP/Myelin P2
AF5866
Western Blot FABP8/M-FABP/Myelin P2 Protein Antibody
Immunohistochemistry FABP8/M-FABP/Myelin P2 Protein Antibody
Immunohistochemistry FABP8/M-FABP/Myelin P2 Protein Antibody
Species: Hu
Applications: IHC, WB
MKS1 Antibody
NBP1-88692
Immunohistochemistry-Paraffin MKS1 Antibody
Immunohistochemistry-Paraffin MKS1 Antibody
Immunohistochemistry-Paraffin MKS1 Antibody
Species: Hu, Rt
Applications: IHC, IHC-P, WB
Recombinant Human
FIG4 GST (N-Term) Pro ...
H00009896-P01
SDS-PAGE Recombinant Human FIG4 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
ARL13B Antibody
NBP2-15463
Western Blot ARL13B Antibody
Immunohistochemistry-Paraffin ARL13B Antibody
Immunocytochemistry/ Immunofluorescence ARL13B Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PIK3CA Antibody
NBP2-19804
Western Blot PIK3CA Antibody
Immunohistochemistry-Paraffin PIK3CA Antibody
Western Blot PIK3CA Antibody
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
PI 3-Kinase p110
beta/PIK3CB Antibody ...
MAB2686
Western Blot PI 3-Kinase p110 beta/PIK3CB Antibody (269020)
(5 Publications)
Species: Hu
Applications: WB
SHIP2/INPPL1
Antibody (3E6)
H00003636-M01
Western Blot SHIP2/INPPL1 Antibody (3E6)
ELISA SHIP2/INPPL1 Antibody (3E6)
(1 Review)
(10 Publications)
Species: Hu, Pm
Applications: ELISA, ICC/IF, WB
PI 3-Kinase p110
gamma Antibody
NBP2-15071
Western Blot PI 3-Kinase p110 gamma Antibody
Western Blot PI 3-Kinase p110 gamma Antibody
Immunohistochemistry-Paraffin PI 3-Kinase p110 gamma Antibody
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
PI 3-Kinase p110
delta Antibody (27514 ...
MAB2687
Western Blot PI 3-Kinase p110 delta Antibody (275144)
Western Blot PI 3-Kinase p110 delta Antibody (275144)
(3 Publications)
Species: Hu
Applications: WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
AHI1 Antibody
NBP2-15309
Immunocytochemistry/ Immunofluorescence AHI1 Antibody
Immunohistochemistry-Paraffin AHI1 Antibody
Western Blot AHI1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Clusterin/APOJ
Antibody [Unconjugate
AF2747
Immunohistochemistry Clusterin/APOJ Antibody [Unconjugated]
Immunohistochemistry Clusterin/APOJ Antibody [Unconjugated]
Western Blot Clusterin/APOJ Antibody [Unconjugated]
(13 Publications)
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
INPP5E Recombinant
Protein Antigen
NBP2-49463PEP
INPP5E Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for INPP5E Recombinant Protein Antigen (NBP2-49463PEP) (0)

There are no publications for INPP5E Recombinant Protein Antigen (NBP2-49463PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for INPP5E Recombinant Protein Antigen (NBP2-49463PEP) (0)

There are no reviews for INPP5E Recombinant Protein Antigen (NBP2-49463PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for INPP5E Recombinant Protein Antigen (NBP2-49463PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional INPP5E Products

Research Areas for INPP5E Recombinant Protein Antigen (NBP2-49463PEP)

Find related products by research area.

Blogs on INPP5E

There are no specific blogs for INPP5E, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our INPP5E Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol INPP5E