Novus Biologicals products are now on bio-techne.com

Importin beta/KPNB1 Recombinant Protein Antigen

Images

 
There are currently no images for Importin beta/KPNB1 Recombinant Protein Antigen (NBP2-55641PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Importin beta/KPNB1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Importin beta/KPNB1.

Source: E. coli

Amino Acid Sequence: NVCWAFSSLAEAAYEAADVADDQEEPATYCLSSSFELIVQKLLETTDRPDGHQNNLRSSAYESLMEIVKNSAKDCYPAVQKTTLVIMERLQQVLQMESHIQSTSDRIQFNDLQSLLCATLQNVLRK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KPNB1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55641.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Importin beta/KPNB1 Recombinant Protein Antigen

  • IMB1
  • Impnb
  • Importin 1
  • importin 90
  • Importin beta
  • importin beta-1 subunit
  • importin subunit beta-1
  • importin-90
  • IPO1
  • IPOB
  • karyopherin (importin) beta 1
  • Karyopherin subunit beta-1
  • KPNB1
  • MGC2155
  • MGC2156
  • MGC2157
  • NTF97
  • NTF97Pore targeting complex 97 kDa subunit
  • Nuclear factor p97
  • PTAC97

Background

Nucleocytoplasmic transport, a signal- and energy-dependent process, takes place through nuclear pore complexes embedded in the nuclear envelope. The import of proteins containing a nuclear localization signal (NLS) requires the NLS import receptor, a heterodimer of importin alpha and beta subunits also known as karyopherins. Importin alpha binds the NLS-containing cargo in the cytoplasm and importin beta docks the complex at the cytoplasmic side of the nuclear pore complex. In the presence of nucleoside triphosphates and the small GTP binding protein Ran, the complex moves into the nuclear pore complex and the importin subunits dissociate. Importin alpha enters the nucleoplasm with its passenger protein and importin beta remains at the pore. Interactions between importin beta and the FG repeats of nucleoporins are essential in translocation through the pore complex. The protein encoded by this gene is a member of the importin beta family. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61832
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NB100-79807
Species: Hu
Applications: IHC, IHC-P, IP, WB
H00003836-M01
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
NB400-148
Species: ChHa, Ha, Hu, Mu, Po, Pm, Rt
Applications: EM, ICC/IF, IHC, IHC-P, IP, KD, KO, WB
MAB6734
Species: Hu
Applications: IHC
NB100-508
Species: Ha, Hu, Mu, Rt
Applications: ChIP, IP, WB
NB100-79802
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, Simple Western, WB
PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
MAB7665
Species: Hu
Applications: IHC, WB
NBP1-32822
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-79814
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
H00001434-M08
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-83213
Species: Hu
Applications: IHC, IHC-P, WB

Publications for Importin beta/KPNB1 Recombinant Protein Antigen (NBP2-55641PEP) (0)

There are no publications for Importin beta/KPNB1 Recombinant Protein Antigen (NBP2-55641PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Importin beta/KPNB1 Recombinant Protein Antigen (NBP2-55641PEP) (0)

There are no reviews for Importin beta/KPNB1 Recombinant Protein Antigen (NBP2-55641PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Importin beta/KPNB1 Recombinant Protein Antigen (NBP2-55641PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Importin beta/KPNB1 Products

Research Areas for Importin beta/KPNB1 Recombinant Protein Antigen (NBP2-55641PEP)

Find related products by research area.

Blogs on Importin beta/KPNB1

There are no specific blogs for Importin beta/KPNB1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Nrf2 Antibody
NBP1-32822

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Importin beta/KPNB1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KPNB1