Home » Importin-8 » Importin-8 Antibodies » Importin-8 Antibody
Novus Biologicals products are now on bio-techne.com

Importin-8 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: Importin-8 Antibody [NBP2-87625] - WB Suggested Anti-IPO8 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Kidney
Western Blot: Importin-8 Antibody [NBP2-87625] - WB Suggested Anti-IPO8 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Kidney

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Importin-8 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human Importin-8. Peptide sequence: PPAVDAVVGQIVPSILFLFLGLKQVCATRQLVNREDRSKAEKADMEENEE The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
IPO8
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for Importin-8 Antibody

  • FLJ21954
  • FLJ26580
  • Imp8
  • importin 8
  • importin-8
  • RAN binding protein 8
  • Ran-binding protein 8
  • RanBP8
  • RANBP8imp8

Background

The importin-alpha/beta complex and the GTPase Ran mediate nuclear import of proteins with a classical nuclear localization signal. The protein encoded by this gene is a member of a class of approximately 20 potential Ran targets that share a sequence motif related to the Ran-binding site of importin-beta. This protein binds to the nuclear pore complex and, along with RanGTP and RANBP1, inhibits the GAP stimulation of the Ran GTPase. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Importin-7 Antibody
NBP2-27150
Immunohistochemistry-Paraffin Importin-7 Antibody
Western Blot Importin-7 Antibody
(2 Publications)
Species: Hu, Pm, Rt
Applications: IHC, IHC-P, In vitro, WB
GAPDH Antibody
(1D4)
NB300-221
Western Blot GAPDH Antibody (1D4)
Immunocytochemistry/ Immunofluorescence GAPDH Antibody (1D4)
Immunocytochemistry/ Immunofluorescence GAPDH Antibody (1D4)
(19 Reviews)
(431 Publications)
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
HPRT Antibody
NBP1-33527
Western Blot HPRT Antibody
Western Blot HPRT Antibody
Immunohistochemistry-Paraffin HPRT Antibody
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Cyclophilin A
Antibody
NBP1-30993
Western Blot Cyclophilin A Antibody
Western Blot Cyclophilin A Antibody
Knockdown Validated Cyclophilin A Antibody
(2 Publications)
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
EIF3B Antibody
NB100-93302
Immunohistochemistry-Paraffin EIF3B Antibody
Western Blot EIF3B Antibody
Immunoprecipitation EIF3B Antibody
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
PGK1 Antibody
NBP2-19784
Western Blot PGK1 Antibody
Western Blot PGK1 Antibody
Immunocytochemistry/ Immunofluorescence PGK1 Antibody
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt, Ye
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, PLA, WB
beta-Actin
Antibody (AC-15)
NB600-501
Western Blot beta-Actin Antibody (AC-15)
Simple Western beta-Actin Antibody (AC-15)
Western Blot beta-Actin Antibody (AC-15)
(27 Reviews)
(595 Publications)
Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
Actin Gamma 1
Antibody
NB600-533
Western Blot Actin Gamma 1 Antibody
Western Blot Actin Gamma 1 Antibody
Western Blot Actin Gamma 1 Antibody
(6 Publications)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IP, Simple Western, WB
RNA Polymerase
II/POLR2A Antibody (4 ...
NB200-598
Flow Cytometry RNA Polymerase II/POLR2A Antibody (4H8) - Azide and BSA Free
Western Blot RNA Polymerase II/POLR2A Antibody (4H8) - Azide and BSA Free
Western Blot RNA Polymerase II/POLR2A Antibody (4H8) - Azide and BSA Free
(1 Review)
(13 Publications)
Species: Hu, Mu, Pm(-), Ye
Applications: ChIP, CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IP, WB
Claudin-1 Antibody
(1C5-D9)
H00009076-M01
ELISA Claudin-1 Antibody (1C5-D9)
Immunohistochemistry-Paraffin Claudin-1 Antibody (1C5-D9)
Immunohistochemistry-Paraffin Claudin-1 Antibody (1C5-D9)
(2 Reviews)
(26 Publications)
Species: Hu, Pm, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
beta
2-Microglobulin Antib ...
NB500-317
Western Blot beta 2-Microglobulin Antibody (B2M-01) - BSA Free
Flow Cytometry beta 2-Microglobulin Antibody (B2M-01) - BSA Free
ELISA beta 2-Microglobulin Antibody (B2M-01) - BSA Free
(1 Review)
(3 Publications)
Species: Bv(-), Ca(-), Ch(-), Hu, Mu(-), Rb(-)
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA, WB
RPLP2 Antibody
NBP2-15104
Immunocytochemistry/ Immunofluorescence RPLP2 Antibody
Immunohistochemistry-Paraffin RPLP2 Antibody
Western Blot RPLP2 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
beta-Actin
Antibody (AC-15)
NB600-501
Western Blot beta-Actin Antibody (AC-15)
Simple Western beta-Actin Antibody (AC-15)
Western Blot beta-Actin Antibody (AC-15)
(27 Reviews)
(595 Publications)
Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
RPLP0 Antibody
NBP1-82859
Immunohistochemistry-Paraffin RPLP0 Antibody
Immunohistochemistry-Paraffin RPLP0 Antibody
Immunohistochemistry-Paraffin RPLP0 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Recombinant Human
TATA binding protein ...
H00006908-Q01
SDS-PAGE Recombinant Human TATA binding protein TBP GST (N-Term) Protein
(5 Publications)
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
14-3-3 zeta
Antibody (818515) [Un ...
MAB2669
Simple Western 14-3-3 zeta Antibody (818515) [Unconjugated]
Western Blot 14-3-3 zeta Antibody (818515) [Unconjugated]
Immunohistochemistry 14-3-3 zeta Antibody (818515) [Unconjugated]
(2 Reviews)
(1 Publication)
Species: Hu
Applications: IHC, Simple Western, WB
UCN2 Antibody
NBP3-12450
Immunohistochemistry-Paraffin UCN2 Antibody
Immunohistochemistry-Paraffin UCN2 Antibody
Immunohistochemistry-Paraffin UCN2 Antibody
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
SRP19 Antibody
NBP3-38326
Immunohistochemistry SRP19 Antibody
Immunohistochemistry SRP19 Antibody
Western Blot SRP19 Antibody
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Karyopherin
(importin) beta 3 Ant ...
H00003843-M01
Western Blot Karyopherin (importin) beta 3 Antibody (1C4)
Immunohistochemistry-Paraffin Karyopherin (importin) beta 3 Antibody (1C4)
Western Blot Karyopherin (importin) beta 3 Antibody (1C4)
(2 Publications)
Species: Ca, Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Importin-8 Antibody
NBP2-87625
Importin-8 Antibody
Species: Hu
Applications: WB

Publications for Importin-8 Antibody (NBP2-87625) (0)

There are no publications for Importin-8 Antibody (NBP2-87625).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Importin-8 Antibody (NBP2-87625) (0)

There are no reviews for Importin-8 Antibody (NBP2-87625). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Importin-8 Antibody (NBP2-87625) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Importin-8 Products

Research Areas for Importin-8 Antibody (NBP2-87625)

Find related products by research area.

Blogs on Importin-8

There are no specific blogs for Importin-8, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Importin-8 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol IPO8