![Western Blot: ILT3/CD85k/LILRB4 Antibody [NBP3-09945] - Western blot analysis of ILT3/CD85k/LILRB4 in Human OVCAR-3 Whole Cell. Antibody dilution at 1 ug/mL](http://images.novusbio.com/fullsize/ILT3-CD85k-LILRB4-Antibody-Western-Blot-NBP3-09945-img0001.jpg "Western Blot: ILT3/CD85k/LILRB4 Antibody [NBP3-09945] - Western blot analysis of ILT3/CD85k/LILRB4 in Human OVCAR-3 Whole Cell. Antibody dilution at 1 ug/mL")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Immunogen | The immunogen for Anti-ILT3/CD85k/LILRB4 antibody is: synthetic peptide directed towards the C-terminal region of Human LIRB4. Peptide sequence RQGKHRTLAQRQADFQRPPGAAEPEPKDGGLQRRSSPAADVQGENFCAAV |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | LILRB4 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 49 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Flow Cytometry B7-1/CD80 Antibody (37711) [Unconjugated]](https://images.novusbio.com/images2/B71_MAB140_Flow_Cytometry_16025.jpg)
![Immunohistochemistry B7-1/CD80 Antibody (37711) [Unconjugated]](https://images.novusbio.com/images2/B71_MAB140_Immunohistochemistry_17363.jpg)
![Dual RNAscope ISH-IHC Compatible B7-1/CD80 Antibody (37711) [Unconjugated]](https://images.novusbio.com/images2/B71_MAB140_Dual_RNAscope_ISHIHC_23827.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | LILRB4 |
![Flow Cytometry ILT4/CD85d/LILRB2 Antibody (287219) [Unconjugated]](https://images.novusbio.com/images2/LILRB2_MAB2078_Flow_Cytometry_18220.jpg)
![Neutralization ILT4/CD85d/LILRB2 Antibody (287219) [Unconjugated]](https://images.novusbio.com/images2/ILT4_MAB2078_Block_Neutralize_9063.jpg)
![Flow Cytometry ILT3/CD85k/LILRB4 Antibody (293623) [Unconjugated]](https://images.novusbio.com/images2/LILRB4_MAB24251_Flow_Cytometry_19291.jpg)
![N/A IL-10 [Biotin]](https://images.novusbio.com/images2/DATA_IL10_DY417_ELISA_2014.jpg)
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Agonist Activity CD28 Antibody (37407) [Unconjugated]](https://images.novusbio.com/images2/CD28_MAB342_Functional_Assay_2393.jpg)
![Immunocytochemistry CD28 Antibody (37407) [Unconjugated]](https://images.novusbio.com/images2/mab342_human-cd28-mab-clone-37407-immunocytochemistry-31102022134634.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")