![Immunohistochemistry-Paraffin: HSD17B2 Antibody [NBP1-92011] - Analysis in human duodenum and testis tissues. Corresponding HSD17B2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/HSD17B2-Antibody-Immunohistochemistry-Paraffin-NBP1-92011-img0017.jpg "Immunohistochemistry-Paraffin: HSD17B2 Antibody [NBP1-92011] - Analysis in human duodenum and testis tissues. Corresponding HSD17B2 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AVTMFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLEKDILDHLPAEVQEDYGQDYILAQRNFLLLINSLASKDFSPVL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | HSD17B2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot 17 beta-HSD1/HSD17B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/17_beta-HSD1_AF7178_Western_Blot_11632.jpg)
![Immunohistochemistry 17 beta-HSD1/HSD17B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/17_betaHSD1_AF7178_Immunohistochemistry_22701.jpg)
![Simple Western 17 beta-HSD1/HSD17B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/af7178_human-17-beta-hsd1-hsd17b1-affinity-purified-polyclonal-ab-simple-western-1342022125637.jpg)
![Neutralization Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prolactin_AF1445_Block_Neutralize_8779.jpg)
![Western Blot Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prolactin_AF1445_Western_Blot_20179.jpg)
![Immunohistochemistry Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af1445_mouse-rat-prolactin-affinity-purified-polyclonal-ab-immunohistochemistry-19202393922..jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: HSD17B2 Antibody [NBP1-92011] - Analysis in control (vector only transfected HEK293T lysate) and HSD17B2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/HSD17B2-Antibody-Western-Blot-NBP1-92011-img0011.jpg "Western Blot: HSD17B2 Antibody [NBP1-92011] - Analysis in control (vector only transfected HEK293T lysate) and HSD17B2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Immunocytochemistry/Immunofluorescence: HSD17B2 Antibody [NBP1-92011] - Staining of human cell line RT4 shows localization to endoplasmic reticulum. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/HSD17B2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92011-img0006.jpg "Immunocytochemistry/Immunofluorescence: HSD17B2 Antibody [NBP1-92011] - Staining of human cell line RT4 shows localization to endoplasmic reticulum. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: HSD17B2 Antibody [NBP1-92011] - Staining of human small intestine shows moderate to strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/HSD17B2-Antibody-Immunohistochemistry-Paraffin-NBP1-92011-img0012.jpg "Immunohistochemistry-Paraffin: HSD17B2 Antibody [NBP1-92011] - Staining of human small intestine shows moderate to strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: HSD17B2 Antibody [NBP1-92011] - Staining of human urinary bladder shows moderate to strong cytoplasmic positivity in urothelial cells.](http://images.novusbio.com/fullsize/HSD17B2-Antibody-Immunohistochemistry-Paraffin-NBP1-92011-img0014.jpg "Immunohistochemistry-Paraffin: HSD17B2 Antibody [NBP1-92011] - Staining of human urinary bladder shows moderate to strong cytoplasmic positivity in urothelial cells.")
![Immunohistochemistry-Paraffin: HSD17B2 Antibody [NBP1-92011] - Staining of human duodenum shows moderate to strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/HSD17B2-Antibody-Immunohistochemistry-Paraffin-NBP1-92011-img0013.jpg "Immunohistochemistry-Paraffin: HSD17B2 Antibody [NBP1-92011] - Staining of human duodenum shows moderate to strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: HSD17B2 Antibody [NBP1-92011] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.](http://images.novusbio.com/fullsize/HSD17B2-Antibody-Immunohistochemistry-Paraffin-NBP1-92011-img0015.jpg "Immunohistochemistry-Paraffin: HSD17B2 Antibody [NBP1-92011] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.")
![Immunohistochemistry-Paraffin: HSD17B2 Antibody [NBP1-92011] - Staining of human liver shows moderate to strong cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/HSD17B2-Antibody-Immunohistochemistry-Paraffin-NBP1-92011-img0016.jpg "Immunohistochemistry-Paraffin: HSD17B2 Antibody [NBP1-92011] - Staining of human liver shows moderate to strong cytoplasmic positivity in hepatocytes.")
![Simple Western Aldo-keto Reductase 1C1/AKR1C1 Antibody (859026) [Unconjugated]](https://images.novusbio.com/images2/Aldoketo_Reductase_1C1_MAB6529_Simple_Western_17147.jpg)
![Western Blot Aldo-keto Reductase 1C1/AKR1C1 Antibody (859026) [Unconjugated]](https://images.novusbio.com/images2/Aldoketo_Reductase_1C1_MAB6529_Western_Blot_13068.jpg)
![Immunocytochemistry Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Immunocytochemistry__Immunofluorescence_20674.jpg)
![Immunohistochemistry Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Immunohistochemistry_20779.jpg)
![Western Blot Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Western_Blot_5715.jpg)
![Western Blot Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Western_Blot_19121.jpg)
![Immunohistochemistry Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Immunohistochemistry_19158.jpg)
![Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free](https://images.novusbio.com/images/Androgen-R-NR3C4-p-Ser213-p-Ser210-Antibody-156C135-2-Western-Blot-NB100-56603-img0004.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")