Home » HR6A/UBE2A » UBE2A Peptides and Proteins » HR6A/UBE2A Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

HR6A/UBE2A Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for HR6A/UBE2A Recombinant Protein Antigen (NBP2-54946PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

HR6A/UBE2A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HR6A/UBE2A.

Source: E. coli

Amino Acid Sequence: IQSLLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSW

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
UBE2A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-54946.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HR6A/UBE2A Recombinant Protein Antigen

  • EC 6.3.2.19
  • HHR6A
  • HR6A
  • RAD6A
  • RAD6ARAD6 homolog A
  • UBC2
  • UBE2A
  • Ubiquitin carrier protein A
  • ubiquitin-conjugating enzyme E2 A
  • ubiquitin-conjugating enzyme E2A (RAD6 homolog)
  • Ubiquitin-protein ligase A

Background

Nuclear receptor coactivator that directly binds nuclear receptors and stimulates the transcriptional activities in a hormone-dependent fashion. Coactivates expression in an agonist- and AF2-dependent manner. Involved in the coactivation of different nuclear receptors, such as for steroids (GR and ERs), retinoids (RARs and RXRs), thyroid hormone (TRs), vitamin D3 (VDR) and prostanoids (PPARs). Probably functions as a general coactivator, rather than just a nuclear receptor coactivator. May also be involved in the coactivation of the NF-kappa-B pathway. May coactivate expression via a remodeling of chromatin and its interaction with histone acetyltransferase proteins. Involved in placental, cardiac, hepatic and embryonic development. NCOA6 is over-expressed in several breast cancer cell lines.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

HR6B/UBE2B
Antibody (2Z3R2)
NBP3-15271
Immunohistochemistry-Paraffin HR6B/UBE2B Antibody (2Z3R2)
Immunohistochemistry-Paraffin HR6B/UBE2B Antibody (2Z3R2)
Immunohistochemistry-Paraffin HR6B/UBE2B Antibody (2Z3R2)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
DBT Antibody
NBP1-89522
Immunocytochemistry/ Immunofluorescence DBT Antibody
Immunohistochemistry-Paraffin DBT Antibody
Immunohistochemistry-Paraffin DBT Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
UBE2R1/CDC34
Antibody (14B5)
NB500-168
Immunocytochemistry/ Immunofluorescence UBE2R1/CDC34 Antibody (14B5)
Immunohistochemistry-Paraffin UBE2R1/CDC34 Antibody (14B5)
Western Blot UBE2R1/CDC34 Antibody (14B5)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
UbcH5b/UBE2D2
[Unconjugated]
E2-622
UbcH5b/UBE2D2 [Unconjugated]
(45 Publications)
Species: Hu
Applications: EnzAct
RAD18 Antibody
(3H7)
H00056852-M01
Immunocytochemistry/ Immunofluorescence RAD18 Antibody (3H7)
Immunohistochemistry-Paraffin RAD18 Antibody (3H7)
Western Blot RAD18 Antibody (3H7)
(2 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, KD, WB
UBR1 Antibody (2F5)
H00197131-M01
Western Blot UBR1 Antibody (2F5)
Sandwich ELISA UBR1 Antibody (2F5)
(2 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, S-ELISA, WB
ALDH9A1 Antibody
NBP1-89150
Western Blot ALDH9A1 Antibody
Western Blot ALDH9A1 Antibody
Immunohistochemistry-Paraffin ALDH9A1 Antibody
(3 Publications)
Species: Hu, Rt
Applications: IHC, IHC-P, WB
ILT6/CD85e/LILRA3
Antibody (2E9)
H00011026-M01
Western Blot ILT6/CD85e/LILRA3 Antibody (2E9)
(6 Publications)
Species: Hu
Applications: ELISA, WB
Dihydrolipoamide
Dehydrogenase/DLD Ant ...
NBP2-01109
Flow Cytometry Dihydrolipoamide Dehydrogenase/DLD Antibody (OTI6D5)
Western Blot Dihydrolipoamide Dehydrogenase/DLD Antibody (OTI6D5)
Immunohistochemistry-Paraffin Dihydrolipoamide Dehydrogenase/DLD Antibody (OTI6D5)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Histone H2B
Antibody (SD20-63)
NBP2-67753
Flow Cytometry Histone H2B Antibody (SD20-63)
Immunocytochemistry/ Immunofluorescence Histone H2B Antibody (SD20-63)
Immunohistochemistry-Paraffin Histone H2B Antibody (SD20-63)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
PCNA Antibody
(PC10)
NB500-106
Immunocytochemistry/ Immunofluorescence PCNA Antibody (PC10)
Western Blot PCNA Antibody (PC10)
Flow Cytometry PCNA Antibody (PC10)
(5 Reviews)
(46 Publications)
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
UBE2K/E2-25K
Antibody (701316)
MAB6609
Western Blot UBE2K/E2-25K Antibody (701316)
Immunohistochemistry UBE2K/E2-25K Antibody (701316)
(1 Publication)
Species: Hu, Mu
Applications: IHC, WB
Ubiquitin
[Unconjugated]
U-100H
Ubiquitin [Unconjugated]
(139 Publications)
Species: Hu
Applications: EnzAct
Ubiquitin C
Antibody - BSA Free
NBP2-94633
Immunohistochemistry-Paraffin Ubiquitin C Antibody - BSA Free
Immunohistochemistry-Paraffin Ubiquitin C Antibody - BSA Free
Immunohistochemistry-Paraffin Ubiquitin C Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Ubiquitin Antibody
(Ubi-1)
NB300-130
Immunohistochemistry-Paraffin Ubiquitin Antibody (Ubi-1)
Western Blot Ubiquitin Antibody (Ubi-1)
Immunocytochemistry/ Immunofluorescence Ubiquitin Antibody (Ubi-1)
(4 Reviews)
(49 Publications)
Species: Bv, Ce, Ch, Dr, Eq, Hu, Pm, Mu, Pl, Po, Rt, Ze
Applications: IB, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Histone H3
Antibody - BSA Free
NB500-171
Immunohistochemistry-Paraffin Histone H3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Histone H3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Histone H3 Antibody - BSA Free
(8 Reviews)
(34 Publications)
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
CDK2 Antibody
[Unconjugated]
AF4654
Immunocytochemistry CDK2 Antibody [Unconjugated]
Western Blot CDK2 Antibody [Unconjugated]
Western Blot CDK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
Glucose 6
Phosphate Dehydrogena ...
NB100-236
Immunoprecipitation Glucose 6 Phosphate Dehydrogenase Antibody
Western Blot Glucose 6 Phosphate Dehydrogenase Antibody
Western Blot Glucose 6 Phosphate Dehydrogenase Antibody
(19 Publications)
Species: Hu, Mu
Applications: IB, IHC, IHC-Fr, IP, WB
Cdk9 Antibody
(1C4E3)
NBP3-15345
Immunohistochemistry-Paraffin Cdk9 Antibody (1C4E3)
Immunohistochemistry-Paraffin Cdk9 Antibody (1C4E3)
Immunohistochemistry-Paraffin Cdk9 Antibody (1C4E3)
Species: Hu, Mu, Rt
Applications: ChIP, CHIP-SEQ, ELISA, ICC/IF, IHC, IHC-P, IP, WB
HR6A/UBE2A
Recombinant Protein A
NBP2-54946PEP
HR6A/UBE2A Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for HR6A/UBE2A Recombinant Protein Antigen (NBP2-54946PEP) (0)

There are no publications for HR6A/UBE2A Recombinant Protein Antigen (NBP2-54946PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HR6A/UBE2A Recombinant Protein Antigen (NBP2-54946PEP) (0)

There are no reviews for HR6A/UBE2A Recombinant Protein Antigen (NBP2-54946PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HR6A/UBE2A Recombinant Protein Antigen (NBP2-54946PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HR6A/UBE2A Products

Research Areas for HR6A/UBE2A Recombinant Protein Antigen (NBP2-54946PEP)

Find related products by research area.

Blogs on HR6A/UBE2A

There are no specific blogs for HR6A/UBE2A, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Immunocytochemistry/Immunofluorescence: PCNA Antibody (PC10) [NB500-106] - HeLa cells were fixed and permeabilized for 10 minutes using cold (-20C) MeOH. The cells were incubated with anti-PCNA [PC10] at 5 ug/mL overnight at 4C and detected with an anti-mouse IgG Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
PCNA Antibody (PC10)
NB500-106

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HR6A/UBE2A Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol UBE2A