![Western Blot: HES2 Antibody (4H6) [H00054626-M01] - Western Blot detection against Immunogen (34.14 KDa) .](http://images.novusbio.com/fullsize/HES2-Antibody-4H6-Western-Blot-H00054626-M01-img0003.jpg "Western Blot: HES2 Antibody (4H6) [H00054626-M01] - Western Blot detection against Immunogen (34.14 KDa) .")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, ChIP |
| Clone | 4H6 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | HES2 (NP_061962, 41 a.a. ~ 114 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LPLLGRENSNCSKLEKADVLEMTVRFLQELPASSWPTAAPLPCDSYREGYSACVARLARVLPACRVLEPAVSAR |
| Specificity | HES2 (4H6) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | HES2 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.Chromatin Immunoprecipitation was reported in scientific literature. |
|
| Reviewed Applications |
|
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Immunocytochemistry HES-4 Antibody [Unconjugated]](https://images.novusbio.com/images2/HES4_AF3600_Immunocytochemistry__Immunofluorescence_19235.jpg)
| Publication using H00054626-M01 | Applications | Species |
|---|---|---|
| Maraver A, Fernandez-Marcos PJ, Herranz D et al. Therapeutic Effect of Secretase Inhibition in Kras(G12V)-Driven Non-Small Cell Lung Carcinoma by Derepression of DUSP1 and Inhibition of ERK Cancer Cell 2012-08-14 [PMID: 22897852] (Chemotaxis, Human) | Chemotaxis | Human |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
reviewed by:
Verified Customer |
WB | Human | 12/27/2021 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for HES2 Antibody (H00054626-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: HES2 Antibody (4H6) [H00054626-M01] - Analysis of monoclonal antibody to HES2 on HeLa cell . Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize/HES2-Antibody-4H6-Immunocytochemistry-Immunofluorescence-H00054626-M01-img0002.jpg "Immunocytochemistry/Immunofluorescence: HES2 Antibody (4H6) [H00054626-M01] - Analysis of monoclonal antibody to HES2 on HeLa cell . Antibody concentration 10 ug/ml.")
![Chromatin Immunoprecipitation (ChIP) Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Chromatin_Immunoprecipitation_11218.jpg)
![Immunocytochemistry Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Immunocytochemistry_7093.jpg)
![Simple Western Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct3_4_AF1759_Simple_Western_20183.jpg)
![Flow Cytometry EpCAM/TROP1 Antibody [Unconjugated]](https://images.novusbio.com/images2/EpCAM_AF960_Flow_Cytometry_15685.jpg)
![Immunohistochemistry EpCAM/TROP1 Antibody [Unconjugated]](https://images.novusbio.com/images2/EpCAM_AF960_Immunohistochemistry_23512.jpg)
![Immunohistochemistry EpCAM/TROP1 Antibody [Unconjugated]](https://images.novusbio.com/images2/EpCAM_AF960_Immunohistochemistry_23513.jpg)
