Home » HAPLN1 » HAPLN1 Antibodies » HAPLN1 Antibody
Novus Biologicals products are now on bio-techne.com

HAPLN1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: HAPLN1 Antibody [NBP1-85443] - Staining of human cell line U-2 OS shows localization to vesicles.
Immunocytochemistry/ Immunofluorescence: HAPLN1 Antibody [NBP1-85443] - Staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemistry-Paraffin: HAPLN1 Antibody [NBP1-85443] - Staining of human colon.
Immunohistochemistry-Paraffin: HAPLN1 Antibody [NBP1-85443] - Staining of human placenta shows high expression.
Immunohistochemistry-Paraffin: HAPLN1 Antibody [NBP1-85443] - Staining of human prostate shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: HAPLN1 Antibody [NBP1-85443] - Staining in human placenta and prostate tissues using anti-HAPLN1 antibody. Corresponding HAPLN1 RNA-seq data are presented for ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: HAPLN1 Antibody [NBP1-85443] - Staining of human bronchus, cerebral cortex, colon and liver using Anti-HAPLN1 antibody NBP1-85443 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: HAPLN1 Antibody [NBP1-85443] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: HAPLN1 Antibody [NBP1-85443] - Staining of human bronchus.
Immunohistochemistry-Paraffin: HAPLN1 Antibody [NBP1-85443] - Staining of human liver.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

      

Orthogonal Strategies

  

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

HAPLN1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIH
Predicted Species
Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HAPLN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HAPLN1 Protein (NBP1-85443PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HAPLN1 Antibody

  • Cartilage link protein
  • Cartilage-link protein
  • Cartilage-linking protein 1
  • CRTL1
  • CRTL1cartilage linking protein 1
  • HAPLN1
  • hyaluronan and proteoglycan link protein 1
  • Proteoglycan link protein

Background

Th extracellular matrix of cartilage consists of a number of interacting macromolecules that are unique to that tissue. The most studied group of these molecules are those that make up the ternary complex involving proteoglycan monomer, link protein (LP) , and hyaluronic acid (HA). As many as 100 proteoglycan monomers and LPs can be found to interact with a single HA polymer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Aggrecan
Neoepitope Antibody -
NB100-74350
Western Blot Aggrecan Neoepitope Antibody - BSA Free
Western Blot Aggrecan Neoepitope Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Aggrecan Neoepitope Antibody - BSA Free
(32 Publications)
Species: Bv, Ca, Hu, Mu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Versican Antibody
[Unconjugated] - Isof ...
AF3054
Immunocytochemistry Versican Antibody [Unconjugated] - Isoform V0
Immunocytochemistry Versican Antibody [Unconjugated] - Isoform V0
Immunocytochemistry/ Immunofluorescence Versican Antibody [Unconjugated] - Isoform V0
(8 Publications)
Species: Hu
Applications: ICC, IHC, WB
CD44 Antibody
(2C5) [Unconjugated] ...
BBA10
Simple Western CD44 Antibody (2C5) [Unconjugated] - s Pan Specific
Western Blot CD44 Antibody (2C5) [Unconjugated] - s Pan Specific
Immunohistochemistry CD44 Antibody (2C5) [Unconjugated] - s Pan Specific
(5 Reviews)
(49 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
Neurocan Antibody
AF5800
Western Blot Neurocan Antibody
Immunohistochemistry Neurocan Antibody
(20 Publications)
Species: Mu, Rt
Applications: IHC, WB
Brevican Antibody
[Unconjugated]
AF4009
Western Blot Brevican Antibody [Unconjugated]
Immunocytochemistry Brevican Antibody [Unconjugated]
Immunohistochemistry Brevican Antibody [Unconjugated]
(11 Publications)
Species: Hu, Rt
Applications: ICC, IHC, IP, WB
Soluble
Liver/Pancreas Antige
NBP2-20454
Western Blot Soluble Liver/Pancreas Antigen Antibody
Immunohistochemistry-Paraffin Soluble Liver/Pancreas Antigen Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
Lipoprotein a
Antibody (4H1) - BSA
NBP2-37477
ELISA Lipoprotein a Antibody (4H1) - BSA Free
Western Blot Lipoprotein a Antibody (4H1) - BSA Free
Immunocytochemistry/ Immunofluorescence Lipoprotein a Antibody (4H1) - BSA Free
(2 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
HAPLN4 Antibody
[Unconjugated]
AF4085
Immunohistochemistry HAPLN4 Antibody [Unconjugated]
(3 Publications)
Species: Hu
Applications: IHC, IP, WB
Decorin Antibody
[Unconjugated]
AF143
Western Blot Decorin Antibody [Unconjugated]
Simple Western Decorin Antibody [Unconjugated]
Immunohistochemistry Decorin Antibody [Unconjugated]
(29 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
Collagen II
Antibody (5B2.5) - BS
NB600-844
Immunohistochemistry-Paraffin Collagen II Antibody (5B2.5) - BSA Free
Immunohistochemistry-Paraffin Collagen II Antibody (5B2.5) - BSA Free
Western Blot Collagen II Antibody (5B2.5) - BSA Free
(50 Publications)
Species: Ch, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
TSG-6 Antibody
(259820)
MAB2104
TSG-6 Antibody (259820)
(2 Reviews)
(6 Publications)
Species: Hu, Mu
Applications: WB
SOX9 Antibody
[Unconjugated]
AF3075
Immunocytochemistry SOX9 Antibody [Unconjugated]
Western Blot SOX9 Antibody [Unconjugated]
Immunocytochemistry SOX9 Antibody [Unconjugated]
(2 Reviews)
(154 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
Pinin Antibody
NBP1-87784
Immunohistochemistry-Paraffin Pinin Antibody
Immunohistochemistry-Paraffin Pinin Antibody
Immunohistochemistry-Paraffin Pinin Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(811 Publications)
Species: Hu
Applications: BA
Tenascin R Antibody
AF3865
Immunohistochemistry Tenascin R Antibody
(1 Review)
(12 Publications)
Species: Hu
Applications: IHC, WB

COMP/Thrombospondin-5
DCMP0
N/A COMP/Thrombospondin-5 [HRP]
N/A COMP/Thrombospondin-5 [HRP]
(12 Publications)
Species: Hu
Applications: ELISA
Indian
Hedgehog/Ihh Antibody ...
AF1705
Immunohistochemistry Indian Hedgehog/Ihh Antibody - N-Terminus
(3 Publications)
Species: Mu
Applications: IHC, WB
CTGF/CCN2 Antibody
[Unconjugated] - C-te ...
AF660
Immunohistochemistry CTGF/CCN2 Antibody [Unconjugated] - C-terminus
Immunohistochemistry CTGF/CCN2 Antibody [Unconjugated] - C-terminus
Western Blot CTGF/CCN2 Antibody [Unconjugated] - C-terminus
(7 Publications)
Species: Hu
Applications: IHC

Publications for HAPLN1 Antibody (NBP1-85443) (0)

There are no publications for HAPLN1 Antibody (NBP1-85443).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HAPLN1 Antibody (NBP1-85443) (0)

There are no reviews for HAPLN1 Antibody (NBP1-85443). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HAPLN1 Antibody (NBP1-85443) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HAPLN1 Products

Research Areas for HAPLN1 Antibody (NBP1-85443)

Find related products by research area.

Blogs on HAPLN1

There are no specific blogs for HAPLN1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HAPLN1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol HAPLN1