Home » Glycophorin C » Glycophorin C Proteins » Glycophorin C Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Glycophorin C Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Glycophorin C Protein (NBP1-84597PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Glycophorin C Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GYPC.

Source: E. coli

Amino Acid Sequence: RYMYRHKGTYHTNEAKGTEFAESADAALQGDPALQDAGDSSRKEYFI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GYPC
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84597.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Glycophorin C Recombinant Protein Antigen

  • CD236 antigen
  • CD236
  • CD236R
  • GE
  • GLPC
  • glycoconnectin
  • glycophorin C (Gerbich blood group)
  • glycophorin-C
  • glycophorin-D
  • Glycoprotein beta
  • GPCMGC126191
  • GPD
  • GYPD
  • MGC117309
  • MGC126192
  • PAS-2
  • PAS-2'
  • Sialoglycoprotein D

Background

Glycophorin C (GYPC) is an integral membrane glycoprotein. It is a minor species carried by human erythrocytes, butplays an important role in regulating the mechanical stability of red cells. A number of glycophorin C mutations havebeen described. The Gerbich and Yus phenotypes are due to deletion of exon 3 and 2, respectively. The Webb and Duchantigens, also known as glycophorin D, result from single point mutations of the glycophorin C gene. The glycophorin Cprotein has very little homology with glycophorins A and B. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Fucosyltransferase
2/FUT2
7770-GT
Fucosyltransferase 2/FUT2
(2 Publications)
Species: Hu
Applications: EnzAct
SQLE Antibody -
Azide and BSA Free
NBP2-93808
Immunocytochemistry/ Immunofluorescence SQLE Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence SQLE Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence SQLE Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Dystrophin Antibody
NBP1-89953
Immunohistochemistry-Paraffin Dystrophin Antibody
Immunohistochemistry-Paraffin Dystrophin Antibody
Immunohistochemistry-Paraffin Dystrophin Antibody
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Bestrophin 1
Antibody (E6-6) - BSA
NB300-164
Western Blot Bestrophin 1 Antibody (E6-6) - BSA Free
Immunohistochemistry-Paraffin Bestrophin 1 Antibody (E6-6) - BSA Free
Immunohistochemistry-Paraffin Bestrophin 1 Antibody (E6-6) - BSA Free
(1 Review)
(49 Publications)
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, PLA, WB
DMPK Antibody
(713931)
MAB6967
Western Blot DMPK Antibody (713931)
Species: Hu
Applications: WB
Desmocollin-3
Antibody (765129)
MAB7265
Western Blot Desmocollin-3 Antibody (765129)
Immunohistochemistry Desmocollin-3 Antibody (765129)
(1 Review)
Species: Mu
Applications: IHC, WB
Glycophorin C
Antibody
NBP1-84597
Western Blot Glycophorin C Antibody
Immunohistochemistry-Paraffin Glycophorin C Antibody
Immunohistochemistry-Paraffin Glycophorin C Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Ceruloplasmin
Antibody (6C3K9)
NBP3-15868
Immunohistochemistry-Paraffin Ceruloplasmin Antibody (6C3K9)
Immunohistochemistry-Paraffin Ceruloplasmin Antibody (6C3K9)
Immunohistochemistry Ceruloplasmin Antibody (6C3K9)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Fucosyltransferase
3/FUT3 Antibody (2-25 ...
NB500-526
Immunohistochemistry Fucosyltransferase 3/FUT3 Antibody (2-25LE) - BSA Free
Immunohistochemistry Fucosyltransferase 3/FUT3 Antibody (2-25LE) - BSA Free
(3 Publications)
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
HPS4 Antibody -
Azide and BSA Free
NBP3-03965
Immunocytochemistry/ Immunofluorescence HPS4 Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HPS4 Antibody - Azide and BSA Free
Western Blot HPS4 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
MMP-12 Antibody
(SR03-23)
NBP2-67344
Flow Cytometry MMP-12 Antibody (SR03-23)
Immunohistochemistry-Paraffin MMP-12 Antibody (SR03-23)
Immunohistochemistry-Paraffin MMP-12 Antibody (SR03-23)
(9 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
DFNB31 Antibody
(2D12)
H00025861-M05
Immunocytochemistry/ Immunofluorescence DFNB31 Antibody (2D12)
Species: Hu
Applications: ELISA, ICC/IF, WB
TfR (Transferrin
R) Antibody - BSA Fre
NB100-92243
Immunohistochemistry-Paraffin TfR (Transferrin R) Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence TfR (Transferrin R) Antibody - BSA Free
Western Blot TfR (Transferrin R) Antibody - BSA Free
(1 Review)
(18 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PLA, WB
GAPDH Antibody
(1D4)
NB300-221
Western Blot GAPDH Antibody (1D4)
Immunocytochemistry/ Immunofluorescence GAPDH Antibody (1D4)
Immunocytochemistry/ Immunofluorescence GAPDH Antibody (1D4)
(19 Reviews)
(431 Publications)
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
PAR1/Thrombin
Receptor Antibody (N2
NBP1-71770
Western Blot PAR1/Thrombin Receptor Antibody (N2-11)
Immunocytochemistry/ Immunofluorescence PAR1/Thrombin Receptor Antibody (N2-11)
Immunohistochemistry PAR1/Thrombin Receptor Antibody (N2-11)
(10 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr, IHC-P, WB
TXNRD2 Antibody -
BSA Free
NBP2-94256
Immunohistochemistry-Paraffin TXNRD2 Antibody - BSA Free
Western Blot TXNRD2 Antibody - BSA Free
Immunohistochemistry-Paraffin TXNRD2 Antibody - BSA Free
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB

TMEFF2/Tomoregulin-2 A
NBP2-01863
Western Blot TMEFF2/Tomoregulin-2 Antibody (OTI1F9)
Immunohistochemistry-Paraffin TMEFF2/Tomoregulin-2 Antibody (OTI1F9)
Immunohistochemistry-Paraffin TMEFF2/Tomoregulin-2 Antibody (OTI1F9)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Thioredoxin
Reductase 1/TRXR1 Ant ...
MAB7428
Western Blot Thioredoxin Reductase 1/TRXR1 Antibody (489804)
Intracellular Staining by Flow Cytometry Thioredoxin Reductase 1/TRXR1 Antibody (489804)
(5 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ICFlow, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB

Publications for Glycophorin C Protein (NBP1-84597PEP) (0)

There are no publications for Glycophorin C Protein (NBP1-84597PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glycophorin C Protein (NBP1-84597PEP) (0)

There are no reviews for Glycophorin C Protein (NBP1-84597PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Glycophorin C Protein (NBP1-84597PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Glycophorin C Products

Research Areas for Glycophorin C Protein (NBP1-84597PEP)

Find related products by research area.

Blogs on Glycophorin C

There are no specific blogs for Glycophorin C, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Analysis of cell line lysates probed with mouse mAb to GAPDH (theoretical molecular weight: 36 kDa), NB300-221, dilution 1:2,000: [1] protein standard, [2] HEK293, [3] HeLa, [4] SH-SY5Y, [5] COS1, [6] NIH-3T3, and [7] C6 cells. The GAPDH antibody reveals a single band at ~37 kDa in all cell lines. GAPDH is a house keeping protein, the level of which is relatively unaffected by most experimental manipulations, and, as a result, this antibody has been widely used as a western blotting loading control.
GAPDH Antibody (1D4)
NB300-221
Western Blot: Bestrophin 1 Antibody (E6-6) - BSA Free [NB300-164] - Immunoblotting showing the expression of RPE-specific proteins BEST1 (NB300-164), RPE65 (NB100-355), CRALBP, and the loading control beta-Actin in iPSC-RPE cells. Two gels/blots in the same panel were prepared from the same cell lysate of each PSC-RPE to detect BEST1 + beta-Actin, and RPE65 + CRALBP, respectively. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/34061021/) licensed under a CC-BY license.
Bestrophin 1 Antibody (E6-6) - BSA Free
NB300-164

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Glycophorin C Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol GYPC