Glutaminase Antibody (5C4) Summary
Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
Immunogen |
GLS (NP_055720, 580 a.a. ~ 669 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EQRDYDSRTALHVAAAEGHVEVVKFLLEACKVNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGLL |
Specificity |
GLS - glutaminase |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
GLS |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Western Blot 1:500
|
Application Notes |
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA. |
Publications |
|
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Glutaminase Antibody (5C4)
Background
Sahai (1983) [PubMed 6825316] demonstrated phosphate-activated glutaminase (EC 3.5.1.2) in human platelets. It is the major enzyme yielding glutamate from glutamine. Significance of the enzyme derives from its possible implication in behavior disturbances in which glutamate acts as a neurotransmitter (Prusiner, 1981). High heritability of platelet glutaminase was indicated by studies of Sahai and Vogel (1983) [PubMed 6682827] who found an intraclass correlation coefficient of 0.96 for monozygotic twins and 0.53 for dizygotic twins.[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Ye
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu, Pm, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Dr, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, S-ELISA, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IP, WB
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
Publications for Glutaminase Antibody (H00002744-M01)(8)
Showing Publications 1 -
8 of 8.
Publications using H00002744-M01 |
Applications |
Species |
Olimpia P, Roberta B, Pedro H et al. Elucidating the role of N-acetylglucosamine in Group A Carbohydrate for the development of an effective glycoconjugate vaccine against Group A Streptococcus. Carbohydr Polym. 2023-02-23 [PMID: 37028871] |
|
|
Lin J, Lian N, Gao Y Et Al. m6A Methylation Mediates LHPP Acetylation as a Tumour Aerobic Glycolysis Suppressor to Improve the Prognosis of Gastric Cancer Cell Death Dis 2022-05-14 [PMID: 35568711] |
|
|
Polletta L, Vernucci E, Carnevale I et al. SIRT5 regulation of ammonia-induced autophagy and mitophagy. Autophagy 2015-01-01 [PMID: 25700560] |
|
|
Hida H, Mouri A, Ando Y et al. Combination of neonatal PolyI:C and adolescent phencyclidine treatments is required to induce behavioral abnormalities with overexpression of GLAST in adult mice. Behav Brain Res. 2013-09-20 [PMID: 24060653] |
|
|
Reynolds MR, Lane AN, Robertson B et al. Control of glutamine metabolism by the tumor suppressor Rb. Oncogene. 2013-01-28 [PMID: 23353822] |
|
|
Cassago A, Ferreira AP, Ferreira IM et al. Mitochondrial localization and structure-based phosphate activation mechanism of Glutaminase C with implications for cancer metabolism. Proc Natl Acad Sci U S A. 2012-01-06 [PMID: 22228304] |
|
|
Cole JT, Mitala CM, Kundu S et al. Dietary branched chain amino acids ameliorate injury-induced cognitive impairment. Proc Natl Acad Sci U S A. 2009-12-07 [PMID: 19995960] |
|
|
Unterluggauer H, Mazurek S, Lener B et al. Premature senescence of human endothelial cells induced by inhibition of glutaminase. Biogerontology. 2008-03-04 [PMID: 18317946] |
|
|
Reviews for Glutaminase Antibody (H00002744-M01) (0)
There are no reviews for Glutaminase Antibody (H00002744-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Glutaminase Antibody (H00002744-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Glutaminase Products
Research Areas for Glutaminase Antibody (H00002744-M01)
Find related products by research area.
|
Blogs on Glutaminase