![Western Blot: Glucose 6 Phosphate Dehydrogenase Antibody [NBP1-89805] - Analysis using Anti-G6PD antibody NBP1-89805 (A) shows similar pattern to independent antibody NBP1-89804 (B).](http://images.novusbio.com/fullsize/Glucose-6-Phosphate-Dehydrogenase-Antibody-Western-Blot-NBP1-89805-img0021.jpg "Western Blot: Glucose 6 Phosphate Dehydrogenase Antibody [NBP1-89805] - Analysis using Anti-G6PD antibody NBP1-89805 (A) shows similar pattern to independent antibody NBP1-89804 (B).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EVRLQFHDVAGDIFHQQCKRNELVIRVQPNEAVYTKMMTKKPGMFFNPEESELDLTYGNRYKNVKLPDAYERLILDVFCGSQMHFVRSDELREAWRIFTPLLHQIELEKP |
| Marker | Cytosol Marker |
| Predicted Species | Mouse (96%), Rat (96%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | G6PD |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publications using NBP1-89805 | Applications | Species |
|---|---|---|
| Rimmer L Investigating the metabolic changes that accompany skeletal muscle hypertrophy Thesis 2023-01-01 (Western Blot) | Western Blot | |
| Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261] | ||
| Dammeyer P, Arner ES., et al. Human Protein Atlas of redox systems - What can be learnt? Biochim Biophys Acta 2010-07-18 [PMID: 20647035] | ||
| Rimmer L, Geisbrecht E, Chao M et al. Investigating the metabolic changes that accompany skeletal muscle maturation Physiology 2023-05-01 |
Secondary Antibodies |
Isotype Controls |
Research Areas for Glucose 6 Phosphate Dehydrogenase Antibody (NBP1-89805)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | G6PD |
![Immunocytochemistry/Immunofluorescence: Glucose 6 Phosphate Dehydrogenase Antibody [NBP1-89805] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Glucose-6-Phosphate-Dehydrogenase-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89805-img0006.jpg "Immunocytochemistry/Immunofluorescence: Glucose 6 Phosphate Dehydrogenase Antibody [NBP1-89805] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Glucose 6 Phosphate Dehydrogenase Antibody [NBP1-89805] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/Glucose-6-Phosphate-Dehydrogenase-Antibody-Immunohistochemistry-Paraffin-NBP1-89805-img0020.jpg "Immunohistochemistry-Paraffin: Glucose 6 Phosphate Dehydrogenase Antibody [NBP1-89805] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.")
![Western Blot: Glucose 6 Phosphate Dehydrogenase Antibody [NBP1-89805] - Analysis in human cell lines A-549 and HEK293 using anti-G6PD antibody. Corresponding G6PD RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.](http://images.novusbio.com/fullsize/Glucose-6-Phosphate-Dehydrogenase-Antibody-Western-Blot-NBP1-89805-img0015.jpg "Western Blot: Glucose 6 Phosphate Dehydrogenase Antibody [NBP1-89805] - Analysis in human cell lines A-549 and HEK293 using anti-G6PD antibody. Corresponding G6PD RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.")
![Immunohistochemistry-Paraffin: Glucose 6 Phosphate Dehydrogenase Antibody [NBP1-89805] - Staining in human testis and skeletal muscle tissues.. Corresponding G6PD RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Glucose-6-Phosphate-Dehydrogenase-Antibody-Immunohistochemistry-Paraffin-NBP1-89805-img0016.jpg "Immunohistochemistry-Paraffin: Glucose 6 Phosphate Dehydrogenase Antibody [NBP1-89805] - Staining in human testis and skeletal muscle tissues.. Corresponding G6PD RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: Glucose 6 Phosphate Dehydrogenase Antibody [NBP1-89805] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.](http://images.novusbio.com/fullsize/Glucose-6-Phosphate-Dehydrogenase-Antibody-Immunohistochemistry-Paraffin-NBP1-89805-img0017.jpg "Immunohistochemistry-Paraffin: Glucose 6 Phosphate Dehydrogenase Antibody [NBP1-89805] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.")
![Immunohistochemistry-Paraffin: Glucose 6 Phosphate Dehydrogenase Antibody [NBP1-89805] - Staining of human skeletal muscle shows no positivity in myocytes.](http://images.novusbio.com/fullsize/Glucose-6-Phosphate-Dehydrogenase-Antibody-Immunohistochemistry-Paraffin-NBP1-89805-img0018.jpg "Immunohistochemistry-Paraffin: Glucose 6 Phosphate Dehydrogenase Antibody [NBP1-89805] - Staining of human skeletal muscle shows no positivity in myocytes.")
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")