![Western Blot: GIF Antibody [H00002694-D01P] - Analysis of GIF expression in mouse stomach.](http://images.novusbio.com/fullsize/GIF-Antibody-Western-Blot-H00002694-D01P-img0003.jpg "Western Blot: GIF Antibody [H00002694-D01P] - Analysis of GIF expression in mouse stomach.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen | GIF (NP_005133.2, 1 a.a. - 417 a.a.) full-length human protein. MAWFALYLLSLLWATAGTSTQTQSSCSVPSAQEPLVNGIQVLMENSVTSSAYPNPSILIAMNLAGAYNLKAQKLLTYQLMSSDNNDLTIGQLGLTIMALTSSCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAILALCQKNSEATLPIAVRFAKTLLANSSPFNVDTGAMATLALTCMYNKIPVGSEEGYRSLFGQVLKDIVEKISMKIKDNGIIGDIYSTGLAMQALSVTPEPSKKEWNCKKTTDMILNEIKQGKFHNPMSIAQILPSLKGKTYLDVPQVTCSPDHEVQPTLPSNPGPGPTSASNITVIYTINNQLRGVELLFNETINVSVKSGSVLLVVLEEAQRKNPMFKFETTMTSWGLVVSSINNIAENVNHKTYWQFLSGVTPLNEGVADYIPFNHEHITANFTQY |
| Specificity | GIF - gastric intrinsic factor (vitamin B synthesis), |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CBLIF |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against tissue lysate and transfected lysate for WB. It has been used for ELISA. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
![PGA5 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "PGA5 [Unconjugated]")
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CBLIF |
| Entrez |
|
| Uniprot |
|
![Western Blot: GIF Antibody [H00002694-D01P] - Analysis of GIF expression in transfected 293T cell line by GIF polyclonal antibody.Lane 1: GIF transfected lysate(45.40 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/GIF-Antibody-Western-Blot-H00002694-D01P-img0004.jpg "Western Blot: GIF Antibody [H00002694-D01P] - Analysis of GIF expression in transfected 293T cell line by GIF polyclonal antibody.Lane 1: GIF transfected lysate(45.40 KDa).Lane 2: Non-transfected lysate.")
![Immunohistochemistry Cubilin Antibody [Unconjugated]](https://images.novusbio.com/images2/Cubilin_AF3700_Immunohistochemistry_24138.jpg)
![Western Blot Cubilin Antibody [Unconjugated]](https://images.novusbio.com/images2/Cubilin_AF3700_Western_Blot_20441.jpg)
![Simple Western Cubilin Antibody [Unconjugated]](https://images.novusbio.com/images2/Cubilin_AF3700_Simple_Western_20573.jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Bioactivity IL-4 [Unconjugated]](https://images.novusbio.com/images/protein/6507-ilcf_recombinant-human-il-4-cho-expressed-protein-cf-bioactivity-272020133214.jpg)
![Bioactivity IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFNgamma_285IF_2848.jpg)
![SDS-PAGE IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFN-gamma_285-IF_230.jpg)
![SEC-MALS IFN-gamma [Unconjugated]](https://images.novusbio.com/images/285-if_recombinant-human-ifn-gamma-protein-sec-mals-1520239228..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")