Home » GFR alpha-1/GDNF R alpha-1 » GFR alpha-1/GDNF R alpha-1 Proteins » GFR alpha-1/GDNF R alpha-1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

GFR alpha-1/GDNF R alpha-1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for GFR alpha-1/GDNF R alpha-1 Protein (NBP2-14045PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

GFR alpha-1/GDNF R alpha-1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GFRA1.

Source: E. coli

Amino Acid Sequence: IGTVMTPNYIDSSSLSVAPWCDCSNSGNDLEECLKFLNFFKDNTCLK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GFRA1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14045.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GFR alpha-1/GDNF R alpha-1 Recombinant Protein Antigen

  • DKFZp313E1012
  • DKFZp686J0156
  • GDNF family receptor alpha 1
  • GDNF family receptor alpha-1
  • GDNF R alpha-1
  • GDNF receptor alpha-1
  • GDNFRAGFR-ALPHA-1
  • GDNFR-alpha-1
  • GDNFRMGC23045
  • GFR alpha1
  • GFR alpha-1
  • GFRA1
  • GFRa-1
  • GFR-alpha-1
  • Glial cell line-derived neurotrophic factor receptor alpha
  • GPI-linked anchor protein
  • PI-linked cell-surface accessory protein
  • RET ligand 1
  • RET1L
  • RETL1FLJ10561
  • TGF-beta related neurotrophic factor receptor 1
  • TGF-beta-related neurotrophic factor receptor 1
  • TRNR1FLJ31546

Background

Glial cell line-derived neurotrophic factor (GDNF) is a potent survival factor for central and peripheral neurons and is essential for the development of kidneys and the enteric nerves system. Physiological responses to GDNF require the presence of a novel glycosylphosphadidylinositol linked protein GDNFRalpha, which is a cell surface receptor for GDNF (1,2). The cDNAs encoding GDNFRalpha from human, rat, chicken and mouse have been cloned recently (1-5). GDNFRalpha was also termed Ret ligand 1 (RETL1) or TGF-beta-related neurotrophic factor receptor 1 (TrnR1) and nominated as GFRalpha-1 recently (5-7). GFRalpha-1 binds GDNF specifically and mediates activation of the Ret protein tyrosine kinase (PTK). Thus, GDNF, GFRalpha and the Ret PTK form a complex to transduce GDNF signal and to mediate GDNF function.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

GDNF [Unconjugated]
212-GD
Bioactivity GDNF [Unconjugated]
SDS-PAGE GDNF [Unconjugated]
SEC-MALS GDNF [Unconjugated]
(218 Publications)
Species: Hu
Applications: Bind, BA
Ret Antibody
[Unconjugated]
AF482
Immunohistochemistry Ret Antibody [Unconjugated]
Western Blot Ret Antibody [Unconjugated]
Immunohistochemistry Ret Antibody [Unconjugated]
(40 Publications)
Species: Mu
Applications: IHC, WB
Neurturin
1297-NE/CF
Neurturin
(9 Publications)
Species: Hu
Applications: Bind, BA
GFR alpha-2/GDNF R
alpha-2 Antibody [Unc ...
AF429
Immunohistochemistry GFR alpha-2/GDNF R alpha-2 Antibody [Unconjugated]
Immunocytochemistry GFR alpha-2/GDNF R alpha-2 Antibody [Unconjugated]
(25 Publications)
Species: Hu, Mu
Applications: Block, ICC, IHC, WB
Artemin
1085-AR
Artemin
(10 Publications)
Species: Mu
Applications: Bind, BA
NT-3 [Unconjugated]
267-N3
NT-3 [Unconjugated]
(73 Publications)
Species: Hu
Applications: BA
RAPGEF5 Antibody
NBP2-57362
Western Blot RAPGEF5 Antibody
Immunocytochemistry/ Immunofluorescence RAPGEF5 Antibody
Species: Hu
Applications: ICC/IF, WB
Recombinant Human
Persephin Protein
NBP2-35208
SDS-PAGE Recombinant Human Persephin Protein
Species: Hu
Applications: BA, PAGE
CX3CL1/Fractalkine
Antibody [Unconjugate ...
AF365
Neutralization CX3CL1/Fractalkine Antibody [Unconjugated]
Western Blot CX3CL1/Fractalkine Antibody [Unconjugated]
(2 Reviews)
(33 Publications)
Species: Hu
Applications: Neut, WB
GFR alpha-3/GDNF R
alpha-3 Antibody [Unc ...
AF2645
Immunohistochemistry GFR alpha-3/GDNF R alpha-3 Antibody [Unconjugated]
(16 Publications)
Species: Mu
Applications: IHC, WB
BDNF [HRP]
DBD00
N/A BDNF [HRP]
N/A BDNF [HRP]
N/A BDNF [HRP]
(104 Publications)
Species: Hu
Applications: ELISA
Tyrosine
Hydroxylase Antibody
NB300-109
Immunohistochemistry-Frozen Tyrosine Hydroxylase Antibody
Immunohistochemistry Tyrosine Hydroxylase Antibody
Immunohistochemistry Tyrosine Hydroxylase Antibody
(7 Reviews)
(232 Publications)
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NCAM-1/CD56
Antibody [Unconjugate
AF2408
Western Blot NCAM-1/CD56 Antibody [Unconjugated]
Simple Western NCAM-1/CD56 Antibody [Unconjugated]
Immunocytochemistry NCAM-1/CD56 Antibody [Unconjugated]
(24 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, KO, Simple Western, WB
TrkA Antibody
[Unconjugated]
AF1056
Immunohistochemistry TrkA Antibody [Unconjugated]
Western Blot TrkA Antibody [Unconjugated]
Immunohistochemistry TrkA Antibody [Unconjugated]
(45 Publications)
Species: Rt
Applications: IHC, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
GNPDA1 Antibody
NBP2-24653
Western Blot GNPDA1 Antibody
Immunohistochemistry-Paraffin GNPDA1 Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Glucose 6
phosphate isomerase A ...
NBP2-02541
Western Blot Glucose 6 phosphate isomerase Antibody (OTI2D2)
Immunohistochemistry-Paraffin Glucose 6 phosphate isomerase Antibody (OTI2D2)
Immunohistochemistry-Paraffin Glucose 6 phosphate isomerase Antibody (OTI2D2)
(1 Publication)
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
GFR alpha-1/GDNF R
alpha-1 Recombinant P ...
NBP2-14045PEP
GFR alpha-1/GDNF R alpha-1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for GFR alpha-1/GDNF R alpha-1 Protein (NBP2-14045PEP) (0)

There are no publications for GFR alpha-1/GDNF R alpha-1 Protein (NBP2-14045PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GFR alpha-1/GDNF R alpha-1 Protein (NBP2-14045PEP) (0)

There are no reviews for GFR alpha-1/GDNF R alpha-1 Protein (NBP2-14045PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GFR alpha-1/GDNF R alpha-1 Protein (NBP2-14045PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GFR alpha-1/GDNF R alpha-1 Products

Research Areas for GFR alpha-1/GDNF R alpha-1 Protein (NBP2-14045PEP)

Find related products by research area.

Blogs on GFR alpha-1/GDNF R alpha-1

There are no specific blogs for GFR alpha-1/GDNF R alpha-1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GFR alpha-1/GDNF R alpha-1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol GFRA1