Home » GEMIN2 » GEMIN2 Proteins » GEMIN2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

GEMIN2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for GEMIN2 Recombinant Protein Antigen (NBP2-55393PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

GEMIN2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GEMIN2.

Source: E. coli

Amino Acid Sequence: ARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GEMIN2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55393.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GEMIN2 Recombinant Protein Antigen

  • Component of gems 2
  • Gemin-2
  • GEMIN2survival of motor neuron protein-interacting protein 1
  • SIP1-delta
  • SMN interacting protein 1-delta
  • SMN-interacting protein 1
  • survival of motor neuron protein interacting protein 1

Background

SIP1 encodes one of the proteins found in the SMN complex, which consists of the suvival of motor neuron protein and several gemin proteins. The SMN complex is localized to a subnuclear compartment called gems (gemini of coiled bodies) and is required for assembly of spliceosomal snRNPs and for pre-mRNA splicing. This protein interacts directly with the survival of motor neuron protein and it is required for formation of the SMN complex. A knockout mouse targeting the mouse homolog of this gene exhibited disrupted snRNP assembly and motor neuron degeneration.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

ZEB2 Antibody
NBP1-82991
Immunohistochemistry-Paraffin ZEB2 Antibody
Immunohistochemistry-Paraffin ZEB2 Antibody
Immunohistochemistry-Paraffin ZEB2 Antibody
(2 Reviews)
(27 Publications)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
SMN2 Antibody
(2B11-2A9)
H00006607-M01
Immunocytochemistry/ Immunofluorescence SMN2 Antibody (2B11-2A9)
Immunohistochemistry-Paraffin SMN2 Antibody (2B11-2A9)
ELISA SMN2 Antibody (2B11-2A9)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
SMN Antibody (2B1)
NB100-1936
Immunohistochemistry SMN Antibody (2B1)
Western Blot SMN Antibody (2B1)
Immunohistochemistry SMN Antibody (2B1)
(24 Publications)
Species: Hu, Mu, Pm, Rt, Xp, Ze
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
SNRPN Antibody -
BSA Free
NBP2-81851
Western Blot SNRPN Antibody - BSA Free
Immunohistochemistry SNRPN Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence SNRPN Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
E-Cadherin
Antibody [Unconjugate
AF748
Immunocytochemistry E-Cadherin Antibody [Unconjugated]
Immunohistochemistry E-Cadherin Antibody [Unconjugated]
Immunocytochemistry E-Cadherin Antibody [Unconjugated]
(142 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
Stathmin 1
Antibody - BSA Free
NBP1-76798
Knockout Validated Stathmin 1 Antibody - BSA Free
Western Blot Stathmin 1 Antibody - BSA Free
Immunohistochemistry-Paraffin Stathmin 1 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KO, WB
ZEB1 Antibody
NBP1-05987
Immunoprecipitation ZEB1 Antibody
Western Blot ZEB1 Antibody
Immunohistochemistry-Paraffin ZEB1 Antibody
(6 Reviews)
(97 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P, IP, KD, MiAr, Simple Western, Single-Cell Western, WB
SLC22A3 Antibody
NBP1-83976
Immunohistochemistry-Paraffin SLC22A3 Antibody
Immunohistochemistry-Paraffin SLC22A3 Antibody
Immunohistochemistry-Paraffin SLC22A3 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
ITK Antibody
(HL1264) - Azide and ...
NBP3-25538
Immunocytochemistry/ Immunofluorescence ITK Antibody (HL1264) - Azide and BSA Free
Western Blot ITK Antibody (HL1264) - Azide and BSA Free
Immunohistochemistry-Paraffin ITK Antibody (HL1264) - Azide and BSA Free
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Gemin 3 Antibody
(1C9F6) - BSA Free
NBP2-52454
Western Blot Gemin 3 Antibody (1C9F6) - BSA Free
Western Blot Gemin 3 Antibody (1C9F6) - BSA Free
ELISA Gemin 3 Antibody (1C9F6) - BSA Free
Species: Hu, Rt
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, WB
Slug Antibody
(OTI1A6)
NBP2-03886
Flow Cytometry Slug Antibody (OTI1A6)
Western Blot Slug Antibody (OTI1A6)
Immunohistochemistry-Paraffin Slug Antibody (OTI1A6)
(1 Review)
(10 Publications)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
GEMIN6 Antibody
H00079833-B01P
Immunocytochemistry/ Immunofluorescence GEMIN6 Antibody
Western Blot GEMIN6 Antibody
Western Blot GEMIN6 Antibody
Species: Hu
Applications: ICC/IF, WB
Twist-1 Antibody
(10E4E6) - BSA Free
NBP2-37364
Flow Cytometry Twist-1 Antibody (10E4E6) - BSA Free
Flow (Intracellular) Twist-1 Antibody (10E4E6) - BSA Free
Flow Cytometry Twist-1 Antibody (10E4E6) - BSA Free
(1 Review)
(9 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
Vimentin Antibody
NB300-223
Immunocytochemistry/ Immunofluorescence Vimentin Antibody
Immunohistochemistry-Frozen Vimentin Antibody
Immunocytochemistry/ Immunofluorescence Vimentin Antibody
(6 Reviews)
(70 Publications)
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Gemin 4 Antibody
NB110-40591
Western Blot Gemin 4 Antibody
Immunohistochemistry-Paraffin Gemin 4 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Snail Antibody
[Unconjugated]
AF3639
Western Blot Snail Antibody [Unconjugated]
Intracellular Staining by Flow Cytometry Snail Antibody [Unconjugated]
Chromatin Immunoprecipitation (ChIP) Snail Antibody [Unconjugated]
(35 Publications)
Species: Hu
Applications: ChIP, ICC, ICFlow, WB
N-Cadherin
Antibody (13A9)
NBP1-48309
Flow (Intracellular) N-Cadherin Antibody (13A9)
Flow Cytometry N-Cadherin Antibody (13A9)
Immunocytochemistry/ Immunofluorescence N-Cadherin Antibody (13A9)
(2 Reviews)
(41 Publications)
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Gemin 5 Antibody
NB100-61049
Western Blot Gemin 5 Antibody
(8 Publications)
Species: Ba, SyHa, Hu, Po
Applications: IP, WB
EDNRB/Endothelin R
Type B Antibody - BSA ...
NLS54
Immunohistochemistry-Paraffin EDNRB/Endothelin R Type B Antibody - BSA Free
Immunohistochemistry-Paraffin EDNRB/Endothelin R Type B Antibody - BSA Free
Immunohistochemistry-Paraffin EDNRB/Endothelin R Type B Antibody - BSA Free
(3 Publications)
Species: Ca, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
SSTK-IP Antibody
NBP2-33923
Western Blot SSTK-IP Antibody
Immunocytochemistry/ Immunofluorescence SSTK-IP Antibody
Species: Hu
Applications: ICC/IF, WB

Publications for GEMIN2 Recombinant Protein Antigen (NBP2-55393PEP) (0)

There are no publications for GEMIN2 Recombinant Protein Antigen (NBP2-55393PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GEMIN2 Recombinant Protein Antigen (NBP2-55393PEP) (0)

There are no reviews for GEMIN2 Recombinant Protein Antigen (NBP2-55393PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GEMIN2 Recombinant Protein Antigen (NBP2-55393PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GEMIN2 Products

Research Areas for GEMIN2 Recombinant Protein Antigen (NBP2-55393PEP)

Find related products by research area.

Blogs on GEMIN2

There are no specific blogs for GEMIN2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Immunoprecipitation: ZEB1 Antibody [NBP1-05987] - Detection of human ZEB1 by western blot of immunoprecipitates. Samples: Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-ZEB1 antibody NBP1-05987 used for IP at 3 ug per reaction. ZEB1 was also immunoprecipitated by another rabbit anti-ZEB1 antibody. For blotting immunoprecipitated ZEB1, NBP1-05987 was used at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
ZEB1 Antibody
NBP1-05987

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GEMIN2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol GEMIN2