![Western Blot: Gelsolin/GSN Antibody (5O10O1) [NBP3-16138] - Western blot analysis of extracts of various cell lines, using Gelsolin/GSN Rabbit mAb (NBP3-16138) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.](http://images.novusbio.com/fullsize/Gelsolin-GSN-Antibody-5O10O1-Western-Blot-NBP3-16138-img0002.jpg "Western Blot: Gelsolin/GSN Antibody (5O10O1) [NBP3-16138] - Western blot analysis of extracts of various cell lines, using Gelsolin/GSN Rabbit mAb (NBP3-16138) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, IHC |
| Clone | 5O10O1 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 400-500 of human Gelsolin/GSN (NP_000168.1). DQTDGLGLSYLSSHIANVERVPFDAATLHTSTAMAAQHGMDDDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYNWQGAQSTQ |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | GSN |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Gelsolin/GSN Antibody (NBP3-16138)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GSN |
![Immunohistochemistry-Paraffin: Gelsolin/GSN Antibody (5O10O1) [NBP3-16138] - Immunohistochemistry of paraffin-embedded mouse brain using Gelsolin/GSN Rabbit mAb (NBP3-16138) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/Gelsolin-GSN-Antibody-5O10O1-Immunohistochemistry-Paraffin-NBP3-16138-img0001.jpg "Immunohistochemistry-Paraffin: Gelsolin/GSN Antibody (5O10O1) [NBP3-16138] - Immunohistochemistry of paraffin-embedded mouse brain using Gelsolin/GSN Rabbit mAb (NBP3-16138) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.")
![Western Blot: Gelsolin/GSN Antibody (5O10O1) [NBP3-16138] - Western blot analysis of extracts of various cell lines, using Gelsolin/GSN Rabbit mAb (NBP3-16138) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.](http://images.novusbio.com/fullsize/Gelsolin-GSN-Antibody-5O10O1-Western-Blot-NBP3-16138-img0003.jpg "Western Blot: Gelsolin/GSN Antibody (5O10O1) [NBP3-16138] - Western blot analysis of extracts of various cell lines, using Gelsolin/GSN Rabbit mAb (NBP3-16138) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.")
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_6532.jpg)
![Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase3_AF835_Immunohistochemistry_22976.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_9340.jpg)
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22971.jpg)
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22972.jpg)
![Immunocytochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunocytochemistry_9890.jpg)
![Western Blot Angiopoietin-like Protein 2/ANGPTL2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Angiopoietinlike_Protein_2_AF1444_Western_Blot_19840.jpg)
![Western Blot GRB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/GRB2_AF3846_Western_Blot_5355.jpg)
![Immunohistochemistry GRB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/GRB2_AF3846_Immunohistochemistry_6809.jpg)
![Simple Western Vinculin Antibody (728526) [Unconjugated]](https://images.novusbio.com/images2/Vinculin_MAB6896_Simple_Western_16408.jpg)
![Western Blot Vinculin Antibody (728526) [Unconjugated]](https://images.novusbio.com/images2/Vinculin_MAB6896_Western_Blot_11566.jpg)
![Immunohistochemistry Vinculin Antibody (728526) [Unconjugated]](https://images.novusbio.com/images2/Vinculin_MAB6896_Immunohistochemistry_11621.jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")