![Immunohistochemistry-Paraffin: GCAP1 Antibody [NBP2-55158] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/GCAP1-Antibody-Immunohistochemistry-Paraffin-NBP2-55158-img0003.jpg "Immunohistochemistry-Paraffin: GCAP1 Antibody [NBP2-55158] - Staining of human liver shows no positivity in hepatocytes as expected.")
| Reactivity | Hu, Pm, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EYVAALSLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIQAIRAINPCSDTTMTAEEFTDTVFSKIDVNGDGELSLEEFIEGVQKDQMLLDTLTRSLDLTRIVRRLQNGEQDEEGADEAAEAAG |
| Predicted Species | Rat (90%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GUCA1A |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended.. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publication using NBP2-55158 | Applications | Species |
|---|---|---|
| Yamasaki S, Tu H, Matsuyama T et al. A Genetic modification that reduces ON-bipolar cells in hESC-derived retinas enhances functional integration after transplantation iScience 2022-01-01 [PMID: 35024589] (IHC-Fr, Monkey) | IHC-Fr | Monkey |
Secondary Antibodies |
Isotype Controls |
Research Areas for GCAP1 Antibody (NBP2-55158)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GUCA1A |
![Immunohistochemistry-Paraffin: GCAP1 Antibody [NBP2-55158] - Staining of human duodenum shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/GCAP1-Antibody-Immunohistochemistry-Paraffin-NBP2-55158-img0002.jpg "Immunohistochemistry-Paraffin: GCAP1 Antibody [NBP2-55158] - Staining of human duodenum shows no positivity in glandular cells as expected.")
![Immunohistochemistry-Paraffin: GCAP1 Antibody [NBP2-55158] -Staining of human retina shows moderate to strong positivity in photoreceptor layer as well as outer plexiform layer.](http://images.novusbio.com/fullsize/antibody/nbp2-55158_rabbit-polyclonal-gcap1-antibody-immunohistochemistry-paraffin-23120249114..jpg "Immunohistochemistry-Paraffin: GCAP1 Antibody [NBP2-55158] -Staining of human retina shows moderate to strong positivity in photoreceptor layer as well as outer plexiform layer.")
![Immunohistochemistry-Paraffin: GCAP1 Antibody [NBP2-55158] -Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/antibody/nbp2-55158_rabbit-polyclonal-gcap1-antibody-immunohistochemistry-paraffin-23120249235..jpg "Immunohistochemistry-Paraffin: GCAP1 Antibody [NBP2-55158] -Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")