![Immunohistochemistry-Paraffin: Gasdermin-A Antibody [NBP2-48564] - Staining in human skin and skeletal muscle tissues.. Corresponding GSDMA RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Gasdermin-A-Antibody-Immunohistochemistry-Paraffin-NBP2-48564-img0008.jpg "Immunohistochemistry-Paraffin: Gasdermin-A Antibody [NBP2-48564] - Staining in human skin and skeletal muscle tissues.. Corresponding GSDMA RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VGALTELSEAQQKLLVKSMEKKILPVQLKLVESTMEQNFLLDKEGVFPLQPELLSSLGDEELTLTEALVGLSGLEVQRSGPQYMWDPDTLPRLCALYAGLSLLQQLTKAS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GSDMA |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot GRB7 Antibody [Unconjugated]](https://images.novusbio.com/images2/GRB7_AF4856_Western_Blot_5571.jpg)
![Immunohistochemistry GRB7 Antibody [Unconjugated]](https://images.novusbio.com/images2/GRB7_AF4856_Immunohistochemistry_22681.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GSDMA |
![Immunohistochemistry-Paraffin: Gasdermin-A Antibody [NBP2-48564] - Staining of human lymph node, skin, skin and skin, hairy using Anti-GSDMA antibody NBP2-48564 (A) shows similar protein distribution across tissues to independent antibody NBP2-49426 (B).](http://images.novusbio.com/fullsize/Gasdermin-A-Antibody-Immunohistochemistry-Paraffin-NBP2-48564-img0010.jpg "Immunohistochemistry-Paraffin: Gasdermin-A Antibody [NBP2-48564] - Staining of human lymph node, skin, skin and skin, hairy using Anti-GSDMA antibody NBP2-48564 (A) shows similar protein distribution across tissues to independent antibody NBP2-49426 (B).")
![Immunohistochemistry-Paraffin: Gasdermin-A Antibody [NBP2-48564] - Staining of human skin, hairy.](http://images.novusbio.com/fullsize/Gasdermin-A-Antibody-Immunohistochemistry-Paraffin-NBP2-48564-img0012.jpg "Immunohistochemistry-Paraffin: Gasdermin-A Antibody [NBP2-48564] - Staining of human skin, hairy.")
![Immunohistochemistry-Paraffin: Gasdermin-A Antibody [NBP2-48564] - Staining of human skeletal muscle shows no positivity in myocytes.](http://images.novusbio.com/fullsize/Gasdermin-A-Antibody-Immunohistochemistry-Paraffin-NBP2-48564-img0007.jpg "Immunohistochemistry-Paraffin: Gasdermin-A Antibody [NBP2-48564] - Staining of human skeletal muscle shows no positivity in myocytes.")
![Immunohistochemistry-Paraffin: Gasdermin-A Antibody [NBP2-48564] - Staining of human skin shows moderate to strong cytoplasmic positivity in keratinocytes.](http://images.novusbio.com/fullsize/Gasdermin-A-Antibody-Immunohistochemistry-Paraffin-NBP2-48564-img0009.jpg "Immunohistochemistry-Paraffin: Gasdermin-A Antibody [NBP2-48564] - Staining of human skin shows moderate to strong cytoplasmic positivity in keratinocytes.")
![Immunohistochemistry-Paraffin: Gasdermin-A Antibody [NBP2-48564] - Staining of human lymph node.](http://images.novusbio.com/fullsize/Gasdermin-A-Antibody-Immunohistochemistry-Paraffin-NBP2-48564-img0011.jpg "Immunohistochemistry-Paraffin: Gasdermin-A Antibody [NBP2-48564] - Staining of human lymph node.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Immunocytochemistry RUNX3/CBFA3 Antibody (527327) [Unconjugated]](https://images.novusbio.com/images2/RUNX3_MAB3765_Immunocytochemistry_10636.jpg)
![Western Blot RUNX3/CBFA3 Antibody (527327) [Unconjugated]](https://images.novusbio.com/images2/RUNX3_MAB3765_Western_Blot_10662.jpg)
![Simple Western RUNX3/CBFA3 Antibody (527327) [Unconjugated]](https://images.novusbio.com/images2/16364.jpg)
![N/A IL-17/IL-17A [Biotin]](https://images.novusbio.com/images2/DATA_IL17_DY421_ELISA_2448.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")