Novus Biologicals products are now on bio-techne.com

GALNT2 Recombinant Protein Antigen

Name: GALNT2 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-83394PEP
Price: 279 USD

Images

There are currently no images for GALNT2 Protein (NBP1-83394PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

GALNT2 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GALNT2. Source: E. coli Amino Acid Sequence: SCKPFKWYLENVYPELRVPDHQDIAFGALQQGTNCLDTLGHFADGVVGVYECHNAGGNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQQWKFTLNL Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	GALNT2
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83394. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	34 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GALNT2 Recombinant Protein Antigen

GalNAc-T2
GalNAc-T2EC 2.4.1.41
GALNT2
Polypeptide GalNac Transferase 2
polypeptide N-acetylgalactosaminyltransferase 2
pp-GaNTase 2
Protein-UDP acetylgalactosaminyltransferase 2
UDP-GalNAc transferase 2
UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 2
UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 2 (GalNAc-T2)

Background

GALNT2 encodes polypeptide N-acetylgalactosaminyltransferase 2, a member of the GalNAc-transferases family. This family transfers an N-acetyl galactosamine to the hydroxyl group of a serine or threonine residue in the first step of O-linked oligosaccharide biosynthesis. Individual GalNAc-transferases have distinct activities and initiation of O-glycosylation in a cell is regulated by a repertoire of GalNAc-transferases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Angiopoietin-like
Protein 3/ANGPTL3 [HR ...

DANL30

(8 Publications)

Species: Hu

Applications: ELISA

Lipoprotein
Lipase/LPL Antibody [ ...

AF7197

Western Blot Lipoprotein Lipase/LPL Antibody [Unconjugated]

Immunocytochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]

(12 Publications)

Species: Hu, Mu

Applications: ICC, IHC, WB

TRIB1 Antibody

NBP1-55386

(1 Publication)

Species: Hu

Applications: IHC, IHC-P, WB

ABCA1 Antibody -
BSA Free

NB400-105

Immunohistochemistry-Paraffin ABCA1 Antibody - BSA Free

(7 Reviews)

(408 Publications)

Species: Ca, Ch, ChHa, Eq, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt

Applications: B/N, ChIP, ChIP, Dual ISH-IHC, ELISA, Flow, GS, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PCR, Simple Western, WB

Polypeptide GalNac
Transferase 1/GALNT1 ...

AF7140

Species: Hu

Applications: IHC, WB

LIPC Antibody -
BSA Free

NBP3-04922

Species: Hu

Applications: ICC/IF, WB

CHREBP Antibody -
BSA Free

NB400-135

Immunohistochemistry CHREBP Antibody - BSA Free

(7 Reviews)

(151 Publications)

Species: Hu, Mu, Rt

Applications: ChIP, ChIP, GS, IB, ICC/IF, IHC, IHC-P, IP, KD, KO, PAGE, WB

Plastin L Antibody

NBP2-19860

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB

Sortilin Antibody
[Unconjugated]

AF2934

Western Blot Sortilin Antibody [Unconjugated]

Simple Western Sortilin Antibody [Unconjugated]

(8 Reviews)

(18 Publications)

Species: Mu

Applications: Block, IHC, Simple Western, WB

Apolipoprotein
A-I/ApoA1 Antibody - ...

NBP2-52979

Western Blot Apolipoprotein A-I/ApoA1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence Apolipoprotein A-I/ApoA1 Antibody - BSA Free

(1 Review)

Species: Hu, Mu

Applications: Flow, ICC/IF, IHC, IHC-P, WB

CETP Antibody
(ATM192) - BSA Free

NB300-558

Western Blot CETP Antibody (ATM192) - BSA Free

(1 Publication)

Species: Bv, Hu, Rb

Applications: ELISA, ICC/IF, IP, WB

MUC1 Antibody
(SM3) - BSA Free

NB120-22711

Flow Cytometry MUC1 Antibody (SM3) - BSA Free

(14 Publications)

Species: Hu, Mu

Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

MAP4K5 Antibody

NBP1-31234

Immunocytochemistry/ Immunofluorescence MAP4K5 Antibody

Immunohistochemistry-Paraffin MAP4K5 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P, IP, WB

Endothelial Lipase
Antibody

NB400-111

Western Blot Endothelial Lipase Antibody

(6 Publications)

Species: Hu, Mu(-)

Applications: ICC/IF, IHC, IHC-Fr, WB

Apolipoprotein A5
Antibody (1G5G9)

NB400-139

Flow Cytometry Apolipoprotein A5 Antibody (1G5G9)

(3 Publications)

Species: Ha, Hu

Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB

GCKR Antibody
(OTI1E7)

NBP2-03396

Immunohistochemistry-Paraffin GCKR Antibody (OTI1E7)

(1 Publication)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

Thyroglobulin
Antibody (2H11 + 6E1)

NBP2-34294

Immunohistochemistry Thyroglobulin Antibody (2H11 + 6E1)

(3 Reviews)

(1 Publication)

Species: Hu, Mu, Rt

Applications: Flow, IHC, IHC-P

NOD2 Antibody
(2D9) - BSA Free

NB100-524

Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free

(1 Review)

(26 Publications)

Species: Hu, Mu

Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

TATA Element
Modulatory Factor 1 A ...

NBP1-90117

Western Blot TATA Element Modulatory Factor 1 Antibody

(3 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, KD, WB

GALNT2 Recombinant
Protein Antigen

NBP1-83394PEP

Species: Hu

Applications: AC

Publications for GALNT2 Protein (NBP1-83394PEP) (0)

There are no publications for GALNT2 Protein (NBP1-83394PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GALNT2 Protein (NBP1-83394PEP) (0)

There are no reviews for GALNT2 Protein (NBP1-83394PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GALNT2 Protein (NBP1-83394PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GALNT2 Products

Blogs on GALNT2

There are no specific blogs for GALNT2, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Formalin-fixed paraffin-embedded tissue sections of human prostate cancer were probed for ABCA1 mRNA (ACD RNAScope Probe, catalog # 432291; Fast Red chromogen, ACD catalog # 322360). Adjacent tissue section was processed for immunohistochemistry using rabbit polyclonal (Novus Biologicals catalog # NB400-105) at 1.5ug/mL with overnight incubation at 4 degrees Celsius followed by incubation with anti-rabbit IgG VisUCyte HRP Polymer Antibody (Catalog # VC003) and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue). Specific staining was localized to glandular cells.

ABCA1 Antibody - BSA Free
NB400-105

Western blot shows lysates of MOLT-4 human acute lymphoblastic leukemia cell line, HeLa human cervical epithelial carcinoma cell line, and HepG2 human hepatocellular carcinoma cell line. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human Polypeptide GalNac Transferase 2/GALNT2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7507) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Polypeptide GalNac Transferase 2/GALNT2 at approximately 65-70 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.

GALNT2 Antibody
AF7507

CHREBP Antibody - BSA Free
NB400-135

Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524APC (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.

NOD2 Antibody (2D9) - BSA Free
NB100-524

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our GALNT2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

GALNT2

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

GALNT2 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

GALNT2 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for GALNT2 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for GALNT2 Protein (NBP1-83394PEP) (0)

Reviews for GALNT2 Protein (NBP1-83394PEP) (0)

FAQs for GALNT2 Protein (NBP1-83394PEP) (0)

Additional GALNT2 Products

Blogs on GALNT2

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics