Home » Galectin-10 » Galectin-10 Peptides and Proteins » Galectin-10 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Galectin-10 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Galectin-10 Protein (NBP1-87688PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Galectin-10 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CLC.

Source: E. coli

Amino Acid Sequence: LACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVM

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CLC
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87688.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Galectin-10 Recombinant Protein Antigen

  • Charcot-Leyden crystal proteinLGALS10A
  • CLC
  • EC 3.1.1.5
  • eosinophil lysophospholipase
  • GAL10
  • Gal-10
  • galectin 10
  • Galectin10
  • Galectin-10
  • LGALS10
  • LPPL_HUMAN
  • Lysolecithin acylhydrolase
  • MGC149659

Background

Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene is a lysophospholipase expressed in eosinophils and basophils. It hydrolyzes lysophosphatidylcholine to glycerophosphocholine and a free fatty acid. This protein may possess carbohydrate or IgE-binding activities. It is both structurally and functionally related to the galectin family of beta-galactoside binding proteins. It may be associated with inflammation and some myeloid leukemias. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PLA2G4A Antibody
NBP1-31344
Immunocytochemistry/ Immunofluorescence PLA2G4A Antibody
Immunohistochemistry-Paraffin PLA2G4A Antibody
Western Blot PLA2G4A Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Phospholipase B1
Antibody
H00151056-B01P
Western Blot Phospholipase B1 Antibody
(1 Publication)
Species: Hu, Mu
Applications: WB
Galanin Antibody
NBP2-33582
Immunocytochemistry/ Immunofluorescence Galanin Antibody
Immunohistochemistry-Paraffin Galanin Antibody
Immunohistochemistry-Paraffin Galanin Antibody
(1 Review)
(2 Publications)
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
Galectin-1
Antibody [Unconjugate
AF1152
Intracellular Staining by Flow Cytometry Galectin-1 Antibody [Unconjugated]
Simple Western Galectin-1 Antibody [Unconjugated]
Immunohistochemistry Galectin-1 Antibody [Unconjugated]
(4 Reviews)
(22 Publications)
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
MBP-1 Antibody -
Azide and BSA Free
NBP3-04784
Western Blot MBP-1 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin MBP-1 Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence MBP-1 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Galectin-7
Antibody [Unconjugate
AF1339
Western Blot Galectin-7 Antibody [Unconjugated]
Simple Western Galectin-7 Antibody [Unconjugated]
(5 Publications)
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Simple Western, WB
GCET2 Antibody
NBP1-82693
Western Blot GCET2 Antibody
Immunohistochemistry-Paraffin GCET2 Antibody
(1 Review)
Species: Hu
Applications: IHC, IHC-P, WB
Galectin-4
Antibody [Unconjugate
AF2128
Immunohistochemistry Galectin-4 Antibody [Unconjugated]
(5 Publications)
Species: Mu
Applications: IHC, WB
CNTF [Unconjugated]
257-NT
SDS-PAGE CNTF [Unconjugated]
Bioactivity CNTF [Unconjugated]
(63 Publications)
Species: Hu
Applications: BA
EPX Antibody
(rEPO104)
NBP3-07388
Immunohistochemistry-Paraffin EPX Antibody (rEPO104)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P
CLCN5 Antibody
NBP1-69123
Western Blot CLCN5 Antibody
Western Blot CLCN5 Antibody
Western Blot CLCN5 Antibody
Species: Mu, Rt
Applications: WB
CLCNKB Antibody
NBP3-10348
Western Blot CLCNKB Antibody
Species: Hu
Applications: WB
CLCNKA Antibody -
Azide and BSA Free
NBP2-92433
Western Blot CLCNKA Antibody - Azide and BSA Free
Species: Hu, Mu
Applications: WB
MBP Antibody (12)
NB600-717
Immunohistochemistry-Frozen MBP Antibody (12)
Immunohistochemistry-Frozen MBP Antibody (12)
Immunocytochemistry/ Immunofluorescence MBP Antibody (12)
(3 Reviews)
(42 Publications)
Species: Bv
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RIA, RI, WB
MBL Antibody
AF2307
MBL Antibody
(9 Publications)
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
CLCN1 Antibody -
BSA Free
NBP2-92461
Immunohistochemistry-Paraffin CLCN1 Antibody - BSA Free
Western Blot CLCN1 Antibody - BSA Free
Immunohistochemistry-Paraffin CLCN1 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Eosinophil derived
neurotoxin Antibody - ...
NBP3-03635
Western Blot Eosinophil derived neurotoxin Antibody - BSA Free
Immunohistochemistry Eosinophil derived neurotoxin Antibody - BSA Free
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, WB
RNASE3 Antibody
NBP2-33778
Western Blot RNASE3 Antibody
Immunohistochemistry-Paraffin RNASE3 Antibody
Immunohistochemistry-Paraffin RNASE3 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
gp130/CD130 [HRP]
DGP00
N/A gp130/CD130 [HRP]
N/A gp130/CD130 [HRP]
N/A gp130/CD130 [HRP]
(14 Publications)
Species: Hu
Applications: ELISA
Galectin-10
Recombinant Protein A
NBP1-87688PEP
Galectin-10 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Galectin-10 Protein (NBP1-87688PEP) (0)

There are no publications for Galectin-10 Protein (NBP1-87688PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Galectin-10 Protein (NBP1-87688PEP) (0)

There are no reviews for Galectin-10 Protein (NBP1-87688PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Galectin-10 Protein (NBP1-87688PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Galectin-10 Products

Research Areas for Galectin-10 Protein (NBP1-87688PEP)

Find related products by research area.

Blogs on Galectin-10

There are no specific blogs for Galectin-10, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Immunohistochemistry-Frozen: MBP Antibody (12) [NB600-717] - Staining of MBP in mouse spinal cord ventral white matter. Image from verified customer review.
MBP Antibody (12)
NB600-717

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Galectin-10 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CLC