![Western Blot: G6PC3 Antibody [NBP3-03956] - Analysis of extracts of 293T cells, using G6PC3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 3s.](http://images.novusbio.com/fullsize/G6PC3-Antibody-Western-Blot-NBP3-03956-img0002.jpg "Western Blot: G6PC3 Antibody [NBP3-03956] - Analysis of extracts of 293T cells, using G6PC3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 3s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 4-103 of human G6PC3 (NP_612396.1). TLGAGIVIAEALQNQLAWLENVWLWITFLGDPKILFLFYFPAAYYASRRVGIAVLWISLITEWLNLIFKWFLFGDRPFWWVHESGYYSQAPAQVHQFPSS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | G6PC3 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 38 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS with 50% glycerol, pH7.3. |
| Preservative | 0.01% Thimerosal |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for G6PC3 Antibody (NBP3-03956)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | G6PC3 |
![Immunocytochemistry/Immunofluorescence: G6PC3 Antibody [NBP3-03956] - Immunofluorescence analysis of U2OS cells using G6PC3 Rabbit pAb (NBP3-03956) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/G6PC3-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-03956-img0006.jpg "Immunocytochemistry/Immunofluorescence: G6PC3 Antibody [NBP3-03956] - Immunofluorescence analysis of U2OS cells using G6PC3 Rabbit pAb (NBP3-03956) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.")
![Western Blot: G6PC3 Antibody [NBP3-03956] - Analysis of extracts of various cell lines, using G6PC3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 10s.](http://images.novusbio.com/fullsize/G6PC3-Antibody-Western-Blot-NBP3-03956-img0001.jpg "Western Blot: G6PC3 Antibody [NBP3-03956] - Analysis of extracts of various cell lines, using G6PC3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 10s.")
![Immunocytochemistry/Immunofluorescence: G6PC3 Antibody [NBP3-03956] - Immunofluorescence analysis of A-549 cells using G6PC3 Rabbit pAb (NBP3-03956) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/G6PC3-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-03956-img0003.jpg "Immunocytochemistry/Immunofluorescence: G6PC3 Antibody [NBP3-03956] - Immunofluorescence analysis of A-549 cells using G6PC3 Rabbit pAb (NBP3-03956) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.")
![Immunocytochemistry/Immunofluorescence: G6PC3 Antibody [NBP3-03956] - Immunofluorescence analysis of C6 cells using G6PC3 Rabbit pAb (NBP3-03956) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/G6PC3-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-03956-img0004.jpg "Immunocytochemistry/Immunofluorescence: G6PC3 Antibody [NBP3-03956] - Immunofluorescence analysis of C6 cells using G6PC3 Rabbit pAb (NBP3-03956) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.")
![Immunocytochemistry/Immunofluorescence: G6PC3 Antibody [NBP3-03956] - Immunofluorescence analysis of NIH/3T3 cells using G6PC3 Rabbit pAb (NBP3-03956) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/G6PC3-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-03956-img0005.jpg "Immunocytochemistry/Immunofluorescence: G6PC3 Antibody [NBP3-03956] - Immunofluorescence analysis of NIH/3T3 cells using G6PC3 Rabbit pAb (NBP3-03956) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.")
![N/A Neutrophil Elastase/ELA2 [Biotin]](https://images.novusbio.com/images2/DATA_Neutrophil_Elastase_DY451705_ELISA_2461.jpg)
![Western Blot HAX-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/HAX-1_AF5458_Western_Blot_5727.jpg)
![Immunocytochemistry HAX-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/HAX1_AF5458_Immunocytochemistry__Immunofluorescence_18999.jpg)
![Immunocytochemistry/ Immunofluorescence UGRP1/SCGB3A2 Antibody [Unconjugated]](https://images.novusbio.com/images/af3465_mouse-ugrp1-affinity-purified-pab-41202412405138.jpg)
![Intracellular Staining by Flow Cytometry GFI-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/GFI1_AF3540_Flow_Cytometry_23623.jpg)
![Western Blot GFI-1 Antibody [Unconjugated]](https://images.novusbio.com/images/af3540_human-gfi-1-affinity-purified-polyclonal-ab-41202412394973.jpg)
![Western Blot GFI-1 Antibody [Unconjugated]](https://images.novusbio.com/images/af3540_human-gfi-1-affinity-purified-polyclonal-ab-41202412401266.jpg)
![Neutralization G-CSF Antibody (67604) [Unconjugated]](https://images.novusbio.com/images2/G-CSF_MAB414_Block_Neutralize_9188.jpg)
![Immunohistochemistry Uteroglobin/SCGB1A1 Antibody (394324) [Unconjugated]](https://images.novusbio.com/images2/Uteroglobin_MAB4218_Immunohistochemistry_7019.jpg)
![Immunohistochemistry Uteroglobin/SCGB1A1 Antibody (394324) [Unconjugated]](https://images.novusbio.com/images2/Uteroglobin_MAB4218_Immunohistochemistry_9991.jpg)
![N/A IL-5 [HRP]](https://images.novusbio.com/images2/IL-5_M5000_ELISA_237.jpg)
![N/A IL-5 [HRP]](https://images.novusbio.com/images2/DATA_IL5_M5000_ELISA_935.jpg)
![Western Blot G-CSFR/CD114 Antibody (38660) [Unconjugated]](https://images.novusbio.com/images2/GCSF_R_MAB381_Western_Blot_12716.jpg)
![Flow Cytometry G-CSFR/CD114 Antibody (38660) [Unconjugated]](https://images.novusbio.com/images2/mab381_human-g-csf-r-cd114-mab-clone-38660-flow-cytometry-142021122939.jpg)
![Immunocytochemistry SCGF/CLEC11a Antibody (239029) [Unconjugated]](https://images.novusbio.com/images2/SCGF_MAB1904_Immunocytochemistry_6578.jpg)
![Immunohistochemistry SCGF/CLEC11a Antibody (239029) [Unconjugated]](https://images.novusbio.com/images2/SCGF_MAB1904_Immunohistochemistry_6959.jpg)
![Immunohistochemistry SCGF/CLEC11a Antibody (239029) [Unconjugated]](https://images.novusbio.com/images/mab1904_human-scgf-clec11a-mab-clone-239029-4120241252123.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")