G6PC3 Antibody - Azide and BSA Free Summary
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 4-103 of human G6PC3 (NP_612396.1). TLGAGIVIAEALQNQLAWLENVWLWITFLGDPKILFLFYFPAAYYASRRVGIAVLWISLITEWLNLIFKWFLFGDRPFWWVHESGYYSQAPAQVHQFPSS |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
G6PC3 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Western Blot 1:500 - 1:1000
|
Theoretical MW |
38 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS with 50% glycerol, pH7.3. |
Preservative |
0.01% Thimerosal |
Purity |
Affinity purified |
Alternate Names for G6PC3 Antibody - Azide and BSA Free
Background
Glucose-6-phosphatase (G6Pase) is located in the endoplasmic reticulum (ER) and catalyzes hydrolysis of G6P to glucose and phosphate, the last step of the gluconeogenic and glycogenolytic pathways. G6PC3 is a ubiquitously expressed G6Pase catalytic subunit (Martin et al., 2002 [PubMed 12370122]; Guionie et al., 2003 [PubMed 12965222]).[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: ICC, WB
Species: Hu, Mu, Pm, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
Species: Mu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Neut, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Neut, WB
Species: Mu
Applications: ELISA
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC, IHC, WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for G6PC3 Antibody (NBP3-03956) (0)
There are no publications for G6PC3 Antibody (NBP3-03956).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for G6PC3 Antibody (NBP3-03956) (0)
There are no reviews for G6PC3 Antibody (NBP3-03956).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for G6PC3 Antibody (NBP3-03956) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional G6PC3 Products
Research Areas for G6PC3 Antibody (NBP3-03956)
Find related products by research area.
|
Blogs on G6PC3