Frizzled-4 Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEECHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSA |
Predicted Species |
Mouse (95%), Rat (99%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
FZD4 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for Frizzled-4 Antibody
Background
FZD4 is a Frizzled Receptor involved in mediating Wnt signaling. A splicing variant of frizzled-4, FZD4s, encodes a soluble-type positive regulator of the Wnt signaling pathway. Mutations in FZD4 are associated with retinal angiogenesis. FZD4 is widely expressed, particularly in heart, skeletal muscle, ovary, and fetal kidney. Transcripts have also been identified in liver, kidney, pancreas, spleen, and fetal lung, and in smaller amounts in placenta, adult lung, prostate, testis, colon, and fetal brain. FZD4 expression has not been reported in several cancer cell lines studied. ESTs have been isolated from adipose, adrenal, B-cell/lung/testis, bone marrow, brain, breast, colon, embryo, gallbladder, head/neck, heart, heart/melanocyte/uterus, kidney, liver, liver/spleen, lung, placenta, prostate, skeletal muscle, skin, and vessel libraries.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC, Neut, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Publications for Frizzled-4 Antibody (NBP2-57807) (0)
There are no publications for Frizzled-4 Antibody (NBP2-57807).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Frizzled-4 Antibody (NBP2-57807) (0)
There are no reviews for Frizzled-4 Antibody (NBP2-57807).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Frizzled-4 Antibody (NBP2-57807) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Frizzled-4 Products
Research Areas for Frizzled-4 Antibody (NBP2-57807)
Find related products by research area.
|
Blogs on Frizzled-4