![Western Blot: FoxP2 Antibody [NBP1-86671] - Analysis in human cell line RH-30.](http://images.novusbio.com/fullsize/FoxP2-Antibody-Western-Blot-NBP1-86671-img0008.jpg "Western Blot: FoxP2 Antibody [NBP1-86671] - Analysis in human cell line RH-30.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AQQLVFQQQLLQMQQLQQQQHLLSLQRQGLISIPPGQAALPVQSLPQAGLSPAEIQQLWKEVTGVHSMEDNGIKHGGLDLTTNNSSSTTSSNTSKASPPITHHS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FOXP2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FOXP2 |
![Immunohistochemistry: FoxP2 Antibody [NBP1-86671] - Patterns of neocortical layer markers in the OT. Both CTIP2 and FOXP2 cells were broadly present in Layer 2 and scattered in Layer 3. Dorsal to top, lateral to right. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/26407299/) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/FoxP2-Antibody-Immunohistochemistry-NBP1-86671-img0009.jpg "Immunohistochemistry: FoxP2 Antibody [NBP1-86671] - Patterns of neocortical layer markers in the OT. Both CTIP2 and FOXP2 cells were broadly present in Layer 2 and scattered in Layer 3. Dorsal to top, lateral to right. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/26407299/) licensed under a CC-BY license.")
![Immunohistochemistry-Paraffin: FoxP2 Antibody [NBP1-86671] - Staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons.](http://images.novusbio.com/fullsize/FoxP2-Antibody-Immunohistochemistry-Paraffin-NBP1-86671-img0004.jpg "Immunohistochemistry-Paraffin: FoxP2 Antibody [NBP1-86671] - Staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons.")
![Immunohistochemistry-Paraffin: FoxP2 Antibody [NBP1-86671] - Staining of human rectum shows moderate nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/FoxP2-Antibody-Immunohistochemistry-Paraffin-NBP1-86671-img0005.jpg "Immunohistochemistry-Paraffin: FoxP2 Antibody [NBP1-86671] - Staining of human rectum shows moderate nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: FoxP2 Antibody [NBP1-86671] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.](http://images.novusbio.com/fullsize/FoxP2-Antibody-Immunohistochemistry-Paraffin-NBP1-86671-img0006.jpg "Immunohistochemistry-Paraffin: FoxP2 Antibody [NBP1-86671] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.")
![Immunohistochemistry-Paraffin: FoxP2 Antibody [NBP1-86671] - Staining of human skin shows moderate nuclear positivity in deep epidermal cells.](http://images.novusbio.com/fullsize/FoxP2-Antibody-Immunohistochemistry-Paraffin-NBP1-86671-img0007.jpg "Immunohistochemistry-Paraffin: FoxP2 Antibody [NBP1-86671] - Staining of human skin shows moderate nuclear positivity in deep epidermal cells.")
![Immunocytochemistry/ Immunofluorescence: FoxP2 Antibody [NBP1-86671] - Patterns of neocortical layer markers in the PPC.A) TBR-1 heavily labeled cells in Layer 2 as well as scattered cells in Layer 3. As in the APC many cells in layers 2 & 3 exhibited the deep marker CTIP2 (B). Only widely scattered cells exhibited FOXP2 & DAARP 32 & NOR1 (B,C). The other three makers exhibited very different patterns: CUX 1 staining (E) was strong throughout layers 2 & 3, BRN2 staining much more modest in the same regions, CART was restricted to the middle of layer 2 (F). Scale bar = 200μm. Dorsal to top, lateral to right. Image collected & cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0138541), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-86671_rabbit-polyclonal-foxp2-antibody-310202415371948.jpg "Immunocytochemistry/ Immunofluorescence: FoxP2 Antibody [NBP1-86671] - Patterns of neocortical layer markers in the PPC.A) TBR-1 heavily labeled cells in Layer 2 as well as scattered cells in Layer 3. As in the APC many cells in layers 2 & 3 exhibited the deep marker CTIP2 (B). Only widely scattered cells exhibited FOXP2 & DAARP 32 & NOR1 (B,C). The other three makers exhibited very different patterns: CUX 1 staining (E) was strong throughout layers 2 & 3, BRN2 staining much more modest in the same regions, CART was restricted to the middle of layer 2 (F). Scale bar = 200μm. Dorsal to top, lateral to right. Image collected & cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0138541), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunocytochemistry/ Immunofluorescence: FoxP2 Antibody [NBP1-86671] - Patterns of neocortical layer markers in the OT.A) TBR-1 (A), BRN2 (D) & CART (E) were only found scattered in the very deepest regions of the OT. All four of the deep laminar markers heavily labeled the region. Both CTIP2 & FOXP2 cells were broadly present in Layer 2 & scattered in Layer 3 (Fig 6b). On the medial side most FOXP2 cells coexpressed CTIP2 but the percentage of cells with both markers was reduced laterally. DARRP-32 cells were dense on the lateral side near the APC & in deep regions of the OT, while NOR1 cells were found in Layer 2 in the medial OT (Fig 6c). Scale bar = 200μm. Dorsal to top, lateral to right. Image collected & cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0138541), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-86671_rabbit-polyclonal-foxp2-antibody-310202415394526.jpg "Immunocytochemistry/ Immunofluorescence: FoxP2 Antibody [NBP1-86671] - Patterns of neocortical layer markers in the OT.A) TBR-1 (A), BRN2 (D) & CART (E) were only found scattered in the very deepest regions of the OT. All four of the deep laminar markers heavily labeled the region. Both CTIP2 & FOXP2 cells were broadly present in Layer 2 & scattered in Layer 3 (Fig 6b). On the medial side most FOXP2 cells coexpressed CTIP2 but the percentage of cells with both markers was reduced laterally. DARRP-32 cells were dense on the lateral side near the APC & in deep regions of the OT, while NOR1 cells were found in Layer 2 in the medial OT (Fig 6c). Scale bar = 200μm. Dorsal to top, lateral to right. Image collected & cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0138541), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunocytochemistry/ Immunofluorescence: FoxP2 Antibody [NBP1-86671] - Patterns of neocortical layer markers in the APC.A) TBR-1 heavily labeled cells in Layer 2 as well as scattered cells in Layer 3. Of the 4 deep layer markers (B,C), only CTIP2 exhibited dense staining. The other three (FOXP2, NOR1 & DAARP32) labeled sparse number in Layers 1–3. The dense staining for FOXP2 & DAARP32 seen at the bottom of the figures sharply demarcates the APC from the more ventral OT. The other three makers exhibited very different patterns: BRN2 staining was found more in the ventral APC (D), CUX 1 in the deeper portions of both Layer 2 & 3 (E), & CART in the middle of Layer 2(F). Scale bar = 200μm. Dorsal to top, lateral to right. Image collected & cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0138541), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-86671_rabbit-polyclonal-foxp2-antibody-31020241536375.jpg "Immunocytochemistry/ Immunofluorescence: FoxP2 Antibody [NBP1-86671] - Patterns of neocortical layer markers in the APC.A) TBR-1 heavily labeled cells in Layer 2 as well as scattered cells in Layer 3. Of the 4 deep layer markers (B,C), only CTIP2 exhibited dense staining. The other three (FOXP2, NOR1 & DAARP32) labeled sparse number in Layers 1–3. The dense staining for FOXP2 & DAARP32 seen at the bottom of the figures sharply demarcates the APC from the more ventral OT. The other three makers exhibited very different patterns: BRN2 staining was found more in the ventral APC (D), CUX 1 in the deeper portions of both Layer 2 & 3 (E), & CART in the middle of Layer 2(F). Scale bar = 200μm. Dorsal to top, lateral to right. Image collected & cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0138541), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunocytochemistry/ Immunofluorescence: FoxP2 Antibody [NBP1-86671] - Patterns of neocortical layer markers in the AONpP.A). TBR1-labelled cells were found throughout Layer 2 of the AONpP as well as in the tenia tecta & mitral cell layer of the OB. B, C) Deep markers were differentially distributed in the region. Layer 2 exhibited dense & evenly-spread CTIP2-positive cells (Fig 3b), while NOR1 was found primarily in the dorsal portion of the structure (Fig 3c, top) Cells expressing the other two marker were rare & found primarily in layer 1: DARRP-32 (note dense staining in the glomerular layer of the OB at left, an area containing large numbers of dopaminergic interneurons, Fig 3c; Liu et al, 2013) & FOXP2 (most often found near the OB, Fig 3b). CTIP2 stained cells were also found in layer 1 but never in cells that expressed one of the other markers. The superficial markers were also differentially distributed. Both BRN2 (Fig 3d) & CUX1 (Fig 3e) were observed primarily in deep cells (except in pars medialis, where CUX1-labeled cells spanned the entire region) with highest densities in the region under the LOT (pars lateralis). All CUX1 cells also expressed BRN2, & over 90% of CUX1 & BRN2 cells also expressed CTIP2. The anti-BRN2 antibody also labeled the LOT (right) & RMS (core of the olfactory peduncle). Scale bar = 200μm. Dorsal to top, lateral to right. Image collected & cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0138541), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-86671_rabbit-polyclonal-foxp2-antibody-310202416114782.jpg "Immunocytochemistry/ Immunofluorescence: FoxP2 Antibody [NBP1-86671] - Patterns of neocortical layer markers in the AONpP.A). TBR1-labelled cells were found throughout Layer 2 of the AONpP as well as in the tenia tecta & mitral cell layer of the OB. B, C) Deep markers were differentially distributed in the region. Layer 2 exhibited dense & evenly-spread CTIP2-positive cells (Fig 3b), while NOR1 was found primarily in the dorsal portion of the structure (Fig 3c, top) Cells expressing the other two marker were rare & found primarily in layer 1: DARRP-32 (note dense staining in the glomerular layer of the OB at left, an area containing large numbers of dopaminergic interneurons, Fig 3c; Liu et al, 2013) & FOXP2 (most often found near the OB, Fig 3b). CTIP2 stained cells were also found in layer 1 but never in cells that expressed one of the other markers. The superficial markers were also differentially distributed. Both BRN2 (Fig 3d) & CUX1 (Fig 3e) were observed primarily in deep cells (except in pars medialis, where CUX1-labeled cells spanned the entire region) with highest densities in the region under the LOT (pars lateralis). All CUX1 cells also expressed BRN2, & over 90% of CUX1 & BRN2 cells also expressed CTIP2. The anti-BRN2 antibody also labeled the LOT (right) & RMS (core of the olfactory peduncle). Scale bar = 200μm. Dorsal to top, lateral to right. Image collected & cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0138541), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_6973.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_9671.jpg)
![Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images/mab25031_human-cftr-c-terminus-mab-clone-24-1-41202412513815.jpg)
![Bioactivity Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images2/Sonic_Hedgehog_464SH_2840.jpg)
![SDS-PAGE Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images2/Sonic_Hedgehog_464-SH_341.jpg)
![SEC-MALS Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images/464-sh_recombinant-mouse-sonic-hedgehog-shh-c25ii-n-terminus-sec-mals-642023224324.jpg)
![Simple Western Pax6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax6_AF8150_Simple_Western_17126.jpg)
![Immunocytochemistry Pax6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax6_AF8150_Immunocytochemistry_14427.jpg)
![Western Blot Pax6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax6_AF8150_Western_Blot_14743.jpg)
![Immunohistochemistry Uteroglobin/SCGB1A1 Antibody (394324) [Unconjugated]](https://images.novusbio.com/images2/Uteroglobin_MAB4218_Immunohistochemistry_7019.jpg)
![Immunohistochemistry Uteroglobin/SCGB1A1 Antibody (394324) [Unconjugated]](https://images.novusbio.com/images2/Uteroglobin_MAB4218_Immunohistochemistry_9991.jpg)
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")